Jump to navigation
Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_1950 [new locus tag: SAUSA300_RS10700 ]
- pan locus tag?: SAUPAN001583000
- symbol: SAUSA300_1950
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_1950 [new locus tag: SAUSA300_RS10700 ]
- symbol: SAUSA300_1950
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2112532..2112774
- length: 243
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 3914288 NCBI
- RefSeq: YP_494601 NCBI
- BioCyc: see SAUSA300_RS10700
- MicrobesOnline: 1293465 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAAAATTAATGAATCTTTGAAGAAATTAAAAGAAAAAGGATACAAAGAAAATGAAGAT
AAAGCTATTTTTAATTTAGCTGATGGTACGCTAGAAATTTACATCGACCATGACGAAAAA
ACAATAATTACAGAATTCCATGATTTAAAGGTATTCGTGTCAGAAGATTTAAAAGATAAA
AGTATGGAGAGCGTTATGTATGAATTGGCTGGAATTGATGAGGAGGACAAGGAAAATGAC
TAA60
120
180
240
243
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_1950 [new locus tag: SAUSA300_RS10700 ]
- symbol: SAUSA300_1950
- description: hypothetical protein
- length: 80
- theoretical pI: 4.22213
- theoretical MW: 9358.41
- GRAVY: -0.84875
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9141
- Cytoplasmic Membrane Score: 0.0051
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.0805
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002375
- TAT(Tat/SPI): 0.000107
- LIPO(Sec/SPII): 0.000462
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKINESLKKLKEKGYKENEDKAIFNLADGTLEIYIDHDEKTIITEFHDLKVFVSEDLKDKSMESVMYELAGIDEEDKEND
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: dut < SAUSA300_1950 < SAUSA300_1951 < SAUSA300_1952 < SAUSA300_1953 < SAUSA300_1954 < SAUSA300_1955 < SAUSA300_1956 < SAUSA300_1957 < SAUSA300_1958 < SAUSA300_1959
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]