Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_1952 [new locus tag: SAUSA300_RS10710 ]
- pan locus tag?: SAUPAN001386000
- symbol: SAUSA300_1952
- pan gene symbol?: —
- synonym:
- product: phiPV083 ORF027-like protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_1952 [new locus tag: SAUSA300_RS10710 ]
- symbol: SAUSA300_1952
- product: phiPV083 ORF027-like protein
- replicon: chromosome
- strand: -
- coordinates: 2112993..2113364
- length: 372
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 3914140 NCBI
- RefSeq: YP_494603 NCBI
- BioCyc: see SAUSA300_RS10710
- MicrobesOnline: 1293467 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGAAAGTGAACTATGAAACAGGATTCCAAATAGGCGTAATGGAAGCTAGGTTGAAGAAG
ATGAGAAAACAACGTGATGAGTACAAGAAGCAACGTGACGAGCTTATTGGGGATATAGCT
AAGTTAAGAGAGCGTAACGAAGAGCTGGAGAACATGTGGCGCACGCTTAAAAATGAATTG
TTTGGAAGATACGAATTTTACCGTTTTAGACTTAGCGAACTACAGATTGAGAGCAGAGCG
AACAAGGAAGTAGCTATATATAGAAGAGCTGAAATCAACTTAAGTGTTATATTGTGCCGA
ATGGACAAACTAGACGGAACAAATGAGTTCTACGAATTTTTAGGGCAAATGGAGGATGAC
ACAAATGAATAA60
120
180
240
300
360
372
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_1952 [new locus tag: SAUSA300_RS10710 ]
- symbol: SAUSA300_1952
- description: phiPV083 ORF027-like protein
- length: 123
- theoretical pI: 5.43795
- theoretical MW: 15018
- GRAVY: -0.956911
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Hypothetical protein, SAB1734c homolog [SA bacteriophages 11, Mu50B]
- PFAM: no clan defined OVT1; Major antigen, helical domain (PF24423; HMM-score: 21.9)Cep57_CLD_2; Centrosome localisation domain of PPC89 (PF14197; HMM-score: 18.5)Myosin_tail_1; Myosin tail (PF01576; HMM-score: 18)and 8 morePhage_GP20; Phage minor structural protein GP20 (PF06810; HMM-score: 14.4)TPR_MLP1_2; TPR/MLP1/MLP2-like protein (PF07926; HMM-score: 14)WD40_alt; Alternative WD40 repeat motif (PF14077; HMM-score: 13.7)UBC (CL0208) Knl1_RWD_C; Knl1 RWD C-terminal domain (PF18210; HMM-score: 13.7)no clan defined NYD-SP28_assoc; Sperm tail C-terminal domain (PF14775; HMM-score: 13.5)Cortex-I_coil; Cortexillin coiled-coil region (PF09304; HMM-score: 13)Asd-4; Asd-4-like domain (PF25026; HMM-score: 12)FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 11.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8879
- Cytoplasmic Membrane Score: 0.0025
- Cell wall & surface Score: 0.0008
- Extracellular Score: 0.1089
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006334
- TAT(Tat/SPI): 0.000998
- LIPO(Sec/SPII): 0.002299
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKVNYETGFQIGVMEARLKKMRKQRDEYKKQRDELIGDIAKLRERNEELENMWRTLKNELFGRYEFYRFRLSELQIESRANKEVAIYRRAEINLSVILCRMDKLDGTNEFYEFLGQMEDDTNE
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: dut < SAUSA300_1950 < SAUSA300_1951 < SAUSA300_1952 < SAUSA300_1953 < SAUSA300_1954 < SAUSA300_1955 < SAUSA300_1956 < SAUSA300_1957 < SAUSA300_1958 < SAUSA300_1959
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]