From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1952 [new locus tag: SAUSA300_RS10710 ]
  • pan locus tag?: SAUPAN001386000
  • symbol: SAUSA300_1952
  • pan gene symbol?:
  • synonym:
  • product: phiPV083 ORF027-like protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_1952 [new locus tag: SAUSA300_RS10710 ]
  • symbol: SAUSA300_1952
  • product: phiPV083 ORF027-like protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2112993..2113364
  • length: 372
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAAAGTGAACTATGAAACAGGATTCCAAATAGGCGTAATGGAAGCTAGGTTGAAGAAG
    ATGAGAAAACAACGTGATGAGTACAAGAAGCAACGTGACGAGCTTATTGGGGATATAGCT
    AAGTTAAGAGAGCGTAACGAAGAGCTGGAGAACATGTGGCGCACGCTTAAAAATGAATTG
    TTTGGAAGATACGAATTTTACCGTTTTAGACTTAGCGAACTACAGATTGAGAGCAGAGCG
    AACAAGGAAGTAGCTATATATAGAAGAGCTGAAATCAACTTAAGTGTTATATTGTGCCGA
    ATGGACAAACTAGACGGAACAAATGAGTTCTACGAATTTTTAGGGCAAATGGAGGATGAC
    ACAAATGAATAA
    60
    120
    180
    240
    300
    360
    372


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_1952 [new locus tag: SAUSA300_RS10710 ]
  • symbol: SAUSA300_1952
  • description: phiPV083 ORF027-like protein
  • length: 123
  • theoretical pI: 5.43795
  • theoretical MW: 15018
  • GRAVY: -0.956911

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Hypothetical protein, SAB1734c homolog [SA bacteriophages 11, Mu50B]
  • PFAM:
    no clan defined OVT1; Major antigen, helical domain (PF24423; HMM-score: 21.9)
    Cep57_CLD_2; Centrosome localisation domain of PPC89 (PF14197; HMM-score: 18.5)
    Myosin_tail_1; Myosin tail (PF01576; HMM-score: 18)
    and 8 more
    Phage_GP20; Phage minor structural protein GP20 (PF06810; HMM-score: 14.4)
    TPR_MLP1_2; TPR/MLP1/MLP2-like protein (PF07926; HMM-score: 14)
    WD40_alt; Alternative WD40 repeat motif (PF14077; HMM-score: 13.7)
    UBC (CL0208) Knl1_RWD_C; Knl1 RWD C-terminal domain (PF18210; HMM-score: 13.7)
    no clan defined NYD-SP28_assoc; Sperm tail C-terminal domain (PF14775; HMM-score: 13.5)
    Cortex-I_coil; Cortexillin coiled-coil region (PF09304; HMM-score: 13)
    Asd-4; Asd-4-like domain (PF25026; HMM-score: 12)
    FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 11.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8879
    • Cytoplasmic Membrane Score: 0.0025
    • Cell wall & surface Score: 0.0008
    • Extracellular Score: 0.1089
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.006334
    • TAT(Tat/SPI): 0.000998
    • LIPO(Sec/SPII): 0.002299
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MKVNYETGFQIGVMEARLKKMRKQRDEYKKQRDELIGDIAKLRERNEELENMWRTLKNELFGRYEFYRFRLSELQIESRANKEVAIYRRAEINLSVILCRMDKLDGTNEFYEFLGQMEDDTNE

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]