Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_1953 [new locus tag: SAUSA300_RS10715 ]
- pan locus tag?: SAUPAN001402000
- symbol: SAUSA300_1953
- pan gene symbol?: —
- synonym:
- product: phiPVL ORF051-like protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_1953 [new locus tag: SAUSA300_RS10715 ]
- symbol: SAUSA300_1953
- product: phiPVL ORF051-like protein
- replicon: chromosome
- strand: -
- coordinates: 2113373..2113615
- length: 243
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3913138 NCBI
- RefSeq: YP_494604 NCBI
- BioCyc: see SAUSA300_RS10715
- MicrobesOnline: 1293468 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGACAGATAACGCACGCAAAGAATACCTAAATCAATTCTTTGGATCTAAGAGATATCTG
TATCAGGATAACGAACGAGTGGCACATATTCATGTAGTAAACGGCACTTATTACTTTCAT
GGGCATATCGTACCAGGTTGGCAAGGCGTGAAAAAGACATTTGATACAGCTGAAGAGCTT
GAAACATATATAAAGCAACAGGGTTTGGAATATGAGGAACAGAAGCAACTAACTTTATTT
TAG60
120
180
240
243
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_1953 [new locus tag: SAUSA300_RS10715 ]
- symbol: SAUSA300_1953
- description: phiPVL ORF051-like protein
- length: 80
- theoretical pI: 6.51259
- theoretical MW: 9591.62
- GRAVY: -0.83875
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- hypothetical protein
- PFAM: no clan defined Phage_Orf51; Phage Conserved Open Reading Frame 51 (PF06194; HMM-score: 190.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9724
- Cytoplasmic Membrane Score: 0.0126
- Cell wall & surface Score: 0.0006
- Extracellular Score: 0.0144
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.007554
- TAT(Tat/SPI): 0.00026
- LIPO(Sec/SPII): 0.00044
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTDNARKEYLNQFFGSKRYLYQDNERVAHIHVVNGTYYFHGHIVPGWQGVKKTFDTAEELETYIKQQGLEYEEQKQLTLF
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: dut < SAUSA300_1950 < SAUSA300_1951 < SAUSA300_1952 < SAUSA300_1953 < SAUSA300_1954 < SAUSA300_1955 < SAUSA300_1956 < SAUSA300_1957 < SAUSA300_1958 < SAUSA300_1959
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]