From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_2355 [new locus tag: SAUSA300_RS13005 ]
  • pan locus tag?: SAUPAN005944000
  • symbol: SAUSA300_2355
  • pan gene symbol?:
  • synonym:
  • product: putative lipoprotein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_2355 [new locus tag: SAUSA300_RS13005 ]
  • symbol: SAUSA300_2355
  • product: putative lipoprotein
  • replicon: chromosome
  • strand: -
  • coordinates: 2531490..2531837
  • length: 348
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    GTGGCGACGGTATTATTATTACTAGTCTTTATATCAGGATGTGGTAATGATAAATATGTG
    AAAGAAATAGATGAAGCAGTTAAAATTCAAAATCAAAAACAAGAACAACTTGCCAAAAAA
    GGCAACGGTGATCGTGTTGATCATTTTGAACGCAAAGATGCTAATATTTATGTCTATGAT
    AAGGATAAAATTATCATTTTAGCTTATAAACCTTTGAGTAATGATGAAGTGCATTATTAT
    GCATATGATTTTAGTGATAAACGTGTATCATATAAGCAAGATTTTGATTCGAGACGATAT
    TATCAACAACATGATGCGGATTATCATGAAGAAAATATGACGAACTAG
    60
    120
    180
    240
    300
    348


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_2355 [new locus tag: SAUSA300_RS13005 ]
  • symbol: SAUSA300_2355
  • description: putative lipoprotein
  • length: 115
  • theoretical pI: 5.62382
  • theoretical MW: 13683.1
  • GRAVY: -0.91913

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • FIG01108076: hypothetical protein
  • PFAM:
    NTF2 (CL0051) DUF4467; Domain of unknown function with cystatin-like fold (DUF4467) (PF14729; HMM-score: 126.6)
    and 1 more
    no clan defined DUF5944; Family of unknown function (DUF5944) (PF19369; HMM-score: 12.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0005
    • Cytoplasmic Membrane Score: 0.8441
    • Cell wall & surface Score: 0.0053
    • Extracellular Score: 0.1501
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 0.67
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: Signal peptide LIPO(Sec/SPII) length 13 aa
    • SP(Sec/SPI): 0.001193
    • TAT(Tat/SPI): 0.000221
    • LIPO(Sec/SPII): 0.988538
    • Cleavage Site: CS pos: 13-14. ISG-CG. Pr: 0.9922
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MATVLLLLVFISGCGNDKYVKEIDEAVKIQNQKQEQLAKKGNGDRVDHFERKDANIYVYDKDKIIILAYKPLSNDEVHYYAYDFSDKRVSYKQDFDSRRYYQQHDADYHEENMTN

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]