Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS13005 [old locus tag: SAUSA300_2355 ]
- pan locus tag?: SAUPAN005944000
- symbol: SAUSA300_RS13005
- pan gene symbol?: —
- synonym:
- product: cystatin-like fold lipoprotein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS13005 [old locus tag: SAUSA300_2355 ]
- symbol: SAUSA300_RS13005
- product: cystatin-like fold lipoprotein
- replicon: chromosome
- strand: -
- coordinates: 2531490..2531849
- length: 360
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (2531490..2531849) NCBI
- BioCyc: SAUSA300_RS13005 BioCyc
- MicrobesOnline: see SAUSA300_2355
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301TTGAAGCGATTTGTGGCGACGGTATTATTATTACTAGTCTTTATATCAGGATGTGGTAAT
GATAAATATGTGAAAGAAATAGATGAAGCAGTTAAAATTCAAAATCAAAAACAAGAACAA
CTTGCCAAAAAAGGCAACGGTGATCGTGTTGATCATTTTGAACGCAAAGATGCTAATATT
TATGTCTATGATAAGGATAAAATTATCATTTTAGCTTATAAACCTTTGAGTAATGATGAA
GTGCATTATTATGCATATGATTTTAGTGATAAACGTGTATCATATAAGCAAGATTTTGAT
TCGAGACGATATTATCAACAACATGATGCGGATTATCATGAAGAAAATATGACGAACTAG60
120
180
240
300
360
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS13005 [old locus tag: SAUSA300_2355 ]
- symbol: SAUSA300_RS13005
- description: cystatin-like fold lipoprotein
- length: 119
- theoretical pI: 6.51715
- theoretical MW: 14213.8
- GRAVY: -0.9
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SAUSA300_2355
- PFAM: NTF2 (CL0051) DUF4467; Domain of unknown function with cystatin-like fold (DUF4467) (PF14729; HMM-score: 126.5)and 1 moreno clan defined DUF5944; Family of unknown function (DUF5944) (PF19369; HMM-score: 12.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 9.87
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0007
- Cytoplasmic Membrane Score: 0.8563
- Cell wall & surface Score: 0.0052
- Extracellular Score: 0.1378
- LocateP:
- SignalP: Signal peptide LIPO(Sec/SPII) length 17 aa
- SP(Sec/SPI): 0.000417
- TAT(Tat/SPI): 0.000084
- LIPO(Sec/SPII): 0.999126
- Cleavage Site: CS pos: 17-18. ISG-CG. Pr: 0.9999
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 446742591 NCBI
- RefSeq: WP_000819847 NCBI
- UniProt: see SAUSA300_2355
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKRFVATVLLLLVFISGCGNDKYVKEIDEAVKIQNQKQEQLAKKGNGDRVDHFERKDANIYVYDKDKIIILAYKPLSNDEVHYYAYDFSDKRVSYKQDFDSRRYYQQHDADYHEENMTN
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]