From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_2467 [new locus tag: SAUSA300_RS13680 ]
  • pan locus tag?: SAUPAN006178000
  • symbol: srtA
  • pan gene symbol?: srtA
  • synonym:
  • product: sortase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_2467 [new locus tag: SAUSA300_RS13680 ]
  • symbol: srtA
  • product: sortase
  • replicon: chromosome
  • strand: -
  • coordinates: 2663314..2663934
  • length: 621
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAAAAAATGGACAAATCGATTAATGACAATCGCTGGTGTGGTACTTATCCTAGTGGCA
    GCATATTTGTTTGCTAAACCACATATCGATAATTATCTTCACGATAAAGATAAAGATGAA
    AAGATTGAACAATATGATAAAAATGTAAAAGAACAGGCGAGTAAAGATAAAAAGCAGCAA
    GCTAAACCTCAAATTCCGAAAGATAAATCGAAAGTGGCAGGCTATATTGAAATTCCAGAT
    GCTGATATTAAAGAACCAGTATATCCAGGACCAGCAACACCTGAACAATTAAATAGAGGT
    GTAAGCTTTGCAGAAGAAAATGAATCACTAGATGATCAAAATATTTCAATTGCAGGACAC
    ACTTTCATTGACCGTCCGAACTATCAATTTACAAATCTTAAAGCAGCCAAAAAAGGTAGT
    ATGGTGTACTTTAAAGTTGGTAATGAAACACGTAAGTATAAAATGACAAGTATAAGAGAT
    GTTAAGCCTACAGATGTAGGAGTTCTAGATGAACAAAAAGGTAAAGATAAACAATTAACA
    TTAATTACTTGTGATGATTACAATGAAAAGACAGGCGTTTGGGAAAAACGTAAAATCTTT
    GTAGCTACAGAAGTCAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    621

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_2467 [new locus tag: SAUSA300_RS13680 ]
  • symbol: SrtA
  • description: sortase
  • length: 206
  • theoretical pI: 9.32932
  • theoretical MW: 23540.7
  • GRAVY: -0.792233

Function[edit | edit source]

  • TIGRFAM:
    Cell structure Cell envelope Other sortase (TIGR01076; EC 3.4.22.-; HMM-score: 163.4)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking sortase (TIGR01076; EC 3.4.22.-; HMM-score: 163.4)
    and 3 more
    sortase, marine proteobacterial type (TIGR03784; HMM-score: 34.8)
    Cell structure Cell envelope Other sortase, SrtB family (TIGR03064; EC 3.4.22.71; HMM-score: 30.9)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking sortase, SrtB family (TIGR03064; EC 3.4.22.71; HMM-score: 30.9)
  • TheSEED:  
    Cell Wall and Capsule Gram-Positive cell wall components Sortase  LPXTG specific sortase A
    and 1 more
    Iron acquisition and metabolism Iron acquisition and metabolism - no subcategory Heme, hemin uptake and utilization systems in GramPositives  LPXTG specific sortase A
  • PFAM:
    no clan defined Sortase; Sortase family (PF04203; HMM-score: 74.6)
    and 2 more
    DUF1510; Protein of unknown function (DUF1510) (PF07423; HMM-score: 16.7)
    DUF3959; Protein of unknown function (DUF3959) (PF13105; HMM-score: 13)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 9.87
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0.5
    • N-terminally Anchored Score: 7
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: Signal peptide SP(Sec/SPI) length 25 aa
    • SP(Sec/SPI): 0.670618
    • TAT(Tat/SPI): 0.002414
    • LIPO(Sec/SPII): 0.091978
    • Cleavage Site: CS pos: 25-26. LFA-KP. Pr: 0.4199
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKKWTNRLMTIAGVVLILVAAYLFAKPHIDNYLHDKDKDEKIEQYDKNVKEQASKDKKQQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

  • srtA no polycistronic organisation predicted

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]