Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS00435 [old locus tag: SAUSA300_0084 ]
- pan locus tag?: SAUPAN000488000
- symbol: SAUSA300_RS00435
- pan gene symbol?: cstR
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS00435 [old locus tag: SAUSA300_0084 ]
- symbol: SAUSA300_RS00435
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 92713..92973
- length: 261
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (92713..92973) NCBI
- BioCyc: SAUSA300_RS00435 BioCyc
- MicrobesOnline: see SAUSA300_0084
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAATTATGATAAAAAAATGATTAATCGTATTAATAGAATACAAGGGCAACTAAATGGA
ATTATTAAAATGATGGAGGAAGGAAAAGACTGTAAAGATGTCATTACACAAATAAGTGCA
TCAAAGAGTTCACTCCAACGCTTGATGGGTATCATTATTAGTGAGAATTTAATAGAATGT
GTAAAAGCAGCTGCGGATGATGAAGAAAGCTCCCAAGAGTTAATTAATGAAGCTGTAAAC
TTATTGGTGAAAAGTAAGTAA60
120
180
240
261
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS00435 [old locus tag: SAUSA300_0084 ]
- symbol: SAUSA300_RS00435
- description: hypothetical protein
- length: 86
- theoretical pI: 5.12449
- theoretical MW: 9641.17
- GRAVY: -0.293023
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SAUSA300_0084
- PFAM: no clan defined Trns_repr_metal; Metal-sensitive transcriptional repressor (PF02583; HMM-score: 88.6)and 4 moreMet_repress (CL0057) Antitox_RHH; Antitoxin-like ribbon-helix-helix (PF20605; HMM-score: 16.7)HTH (CL0123) Dimerisation; Plant O-methyltransferase dimerisation domain (PF08100; HMM-score: 14.2)Met_repress (CL0057) DUF7557; Family of unknown function (DUF7557) (PF24434; HMM-score: 13.7)TPR (CL0020) FANCA_arcN; FANCA arcN subdomain (PF24783; HMM-score: 13.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9383
- Cytoplasmic Membrane Score: 0.0054
- Cell wall & surface Score: 0.0114
- Extracellular Score: 0.0449
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004536
- TAT(Tat/SPI): 0.000986
- LIPO(Sec/SPII): 0.000445
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 447027831 NCBI
- RefSeq: WP_001105087 NCBI
- UniProt: see SAUSA300_0084
⊟Protein sequence[edit | edit source]
- MNYDKKMINRINRIQGQLNGIIKMMEEGKDCKDVITQISASKSSLQRLMGIIISENLIECVKAAADDEESSQELINEAVNLLVKSK
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]