Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS04605 [old locus tag: SAUSA300_0853 ]
- pan locus tag?: SAUPAN003051000
- symbol: SAUSA300_RS04605
- pan gene symbol?: mnhC1
- synonym:
- product: Na(+)/H(+) antiporter subunit C
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS04605 [old locus tag: SAUSA300_0853 ]
- symbol: SAUSA300_RS04605
- product: Na(+)/H(+) antiporter subunit C
- replicon: chromosome
- strand: -
- coordinates: 930927..931256
- length: 330
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (930927..931256) NCBI
- BioCyc: SAUSA300_RS04605 BioCyc
- MicrobesOnline: see SAUSA300_0853
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGATTTTTGTTAGTGGTATTCTCACAGCAATTAGTGTCTATCTCGTTTTGTCTAAAAGT
CTGATACGAATTGTTATGGGAACTACACTATTAACACATGCAGCAAATTTATTTTTAATA
ACTATGGGCGGACTTAAACATGGTACTGTTCCAATTTATGAAGCGAACGTAAAAAGCTAT
GTTGATCCTATCCCGCAAGCACTTATTTTAACAGCAATCGTTATCGCCTTTGCGACAACA
GCCTTTTTCTTAGTATTAGCATTTAGAACATATAAAGAATTAGGCACAGATAACGTTGAG
AGTATGAAAGGAGTTCCAGAAGATGATTGA60
120
180
240
300
330
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS04605 [old locus tag: SAUSA300_0853 ]
- symbol: SAUSA300_RS04605
- description: Na(+)/H(+) antiporter subunit C
- length: 109
- theoretical pI: 6.51458
- theoretical MW: 11805.9
- GRAVY: 0.802752
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds multicomponent Na+:H+ antiporter, MnhC subunit (TIGR00941; HMM-score: 168.4)
- TheSEED: see SAUSA300_0853
- PFAM: no clan defined Oxidored_q2; NADH-ubiquinone/plastoquinone oxidoreductase chain 4L (PF00420; HMM-score: 97.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0002
- Cytoplasmic Membrane Score: 0.9976
- Cell wall & surface Score: 0
- Extracellular Score: 0.0022
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.145951
- TAT(Tat/SPI): 0.004358
- LIPO(Sec/SPII): 0.005605
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
- GI: see SAUSA300_0853
- RefSeq: WP_011443624 NCBI
- UniProt: see SAUSA300_0853
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEANVKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- data available for JSNZ
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]