Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS05000 [old locus tag: SAUSA300_0931 ]
- pan locus tag?: SAUPAN003214000
- symbol: SAUSA300_RS05000
- pan gene symbol?: —
- synonym:
- product: DUF2187 domain-containing protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS05000 [old locus tag: SAUSA300_0931 ]
- symbol: SAUSA300_RS05000
- product: DUF2187 domain-containing protein
- replicon: chromosome
- strand: +
- coordinates: 1021330..1021506
- length: 177
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (1021330..1021506) NCBI
- BioCyc: SAUSA300_RS05000 BioCyc
- MicrobesOnline: see SAUSA300_0931
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGACTGTTGCAGAAGTGGGTAACATTGTTGAGTTTATGGATGGATTAAGAGGTCGTGTT
GAAAAAATCAACGATAACTCTGTTATTGTTGACTTAACAATTATGGAAAATTTTAATGAC
CTTGATTTACCGGAAAAAACTGTTATCAATCATAAACGATATAAGATTGTTGAATAA60
120
177
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS05000 [old locus tag: SAUSA300_0931 ]
- symbol: SAUSA300_RS05000
- description: DUF2187 domain-containing protein
- length: 58
- theoretical pI: 4.46294
- theoretical MW: 6676.64
- GRAVY: -0.17069
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein and peptide secretion and trafficking preprotein translocase, YajC subunit (TIGR00739; HMM-score: 13.6)
- TheSEED: see SAUSA300_0931
- PFAM: no clan defined DUF2187; Uncharacterized protein conserved in bacteria (DUF2187) (PF09953; HMM-score: 97.6)and 3 moreNTP_transf (CL0260) DUF2204; Nucleotidyl transferase of unknown function (DUF2204) (PF09970; HMM-score: 14.9)no clan defined YajC; Preprotein translocase subunit (PF02699; HMM-score: 13)Miga; Mitoguardin (PF10265; HMM-score: 11.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005589
- TAT(Tat/SPI): 0.000407
- LIPO(Sec/SPII): 0.001709
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 446137043 NCBI
- RefSeq: WP_000214898 NCBI
- UniProt: see SAUSA300_0931
⊟Protein sequence[edit | edit source]
- MTVAEVGNIVEFMDGLRGRVEKINDNSVIVDLTIMENFNDLDLPEKTVINHKRYKIVE
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SAUSA300_RS04265 arsenate reductase [1] (data from MRSA252) SAUSA300_RS08425 30S ribosomal protein S20 [1] (data from MRSA252) SAUSA300_RS09055 2-Cys peroxiredoxin [1] (data from MRSA252) SAUSA300_RS11460 DNA-directed RNA polymerase subunit delta [1] (data from MRSA252) SAUSA300_RS12065 30S ribosomal protein S5 [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 1.2 1.3 1.4 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)