Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS12355 [old locus tag: SAUSA300_2238 ]
- pan locus tag?: SAUPAN005753000
- symbol: SAUSA300_RS12355
- pan gene symbol?: ureA
- synonym:
- product: urease subunit gamma
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS12355 [old locus tag: SAUSA300_2238 ]
- symbol: SAUSA300_RS12355
- product: urease subunit gamma
- replicon: chromosome
- strand: +
- coordinates: 2405463..2405765
- length: 303
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (2405463..2405765) NCBI
- BioCyc: SAUSA300_RS12355 BioCyc
- MicrobesOnline: see SAUSA300_2238
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301TTGCATTTTACACAACGAGAGCAAGACAAATTAATGATTGTAGTGGCGGCGGAAGTTGCA
CGTCGTCGTAAAGCACGTGGTTTGAAACTAAATCATCCTGAGGCATTAGCTTTAATCAGC
GATGAATTATTAGAAGGTGCACGCGATGGTAAGACCGTTGCAGAGTTAATGAGTTATGGT
AGACAAATTCTAAACAAAGAAGATGTCATGGATGGTGTCGAACACATGATTACAGATATC
GAAATCGAGGCTACGTTCCCCGATGGTACTAAGTTAATCACAGTACATCACCCTATTGTT
TAA60
120
180
240
300
303
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS12355 [old locus tag: SAUSA300_2238 ]
- symbol: SAUSA300_RS12355
- description: urease subunit gamma
- length: 100
- theoretical pI: 5.99184
- theoretical MW: 11273
- GRAVY: -0.233
⊟Function[edit | edit source]
- reaction: EC 3.5.1.5? ExPASyUrease Urea + H2O = CO2 + 2 NH3
- TIGRFAM: Central intermediary metabolism Nitrogen metabolism urease, gamma subunit (TIGR00193; EC 3.5.1.5; HMM-score: 155)
- TheSEED: see SAUSA300_2238
- PFAM: no clan defined Urease_gamma; Urease, gamma subunit (PF00547; HMM-score: 157.8)and 1 morePilP (CL0655) CdsD_C; CdsD C-terminal (PF23862; HMM-score: 12.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9912
- Cytoplasmic Membrane Score: 0.0016
- Cell wall & surface Score: 0
- Extracellular Score: 0.0071
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00565
- TAT(Tat/SPI): 0.001991
- LIPO(Sec/SPII): 0.001087
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 446468074 NCBI
- RefSeq: WP_000545928 NCBI
- UniProt: see SAUSA300_2238
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MHFTQREQDKLMIVVAAEVARRRKARGLKLNHPEALALISDELLEGARDGKTVAELMSYGRQILNKEDVMDGVEHMITDIEIEATFPDGTKLITVHHPIV
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]