Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS12380 [old locus tag: SAUSA300_2243 ]
- pan locus tag?: SAUPAN005758000
- symbol: SAUSA300_RS12380
- pan gene symbol?: ureG
- synonym:
- product: urease accessory protein UreG
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS12380 [old locus tag: SAUSA300_2243 ]
- symbol: SAUSA300_RS12380
- product: urease accessory protein UreG
- replicon: chromosome
- strand: +
- coordinates: 2409061..2409675
- length: 615
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (2409061..2409675) NCBI
- BioCyc: SAUSA300_RS12380 BioCyc
- MicrobesOnline: see SAUSA300_2243
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601GTGGCAAATCCGATTAAAATTGGTATTGGTGGTCCTGTAGGTGCAGGTAAAACACAATTA
ATTGAAAAAGTTGTAAAACGTCTTTCAAAAGAAATGAGTATCGGCGTTATTACAAATGAT
ATATATACAAAAGAAGACGAAAAGATATTAGTAAATTCAGGAGTTCTACCTGAAAGTCGT
ATCATTGGTGTTGAAACTGGTGGATGTCCTCATACTGCGATTCGTGAAGATGCATCTATG
AACTTTGCAGCAATAGACGAATTATTAGAACGTCATGACGATATAGAACTAATTTTCATA
GAATCTGGTGGCGATAACTTAGCAGCAACATTTAGTCCAGAACTTGTTGACTTTTCAATA
TATATTATCGATGTTGCTCAAGGTGAAAAGATTCCACGTAAAGGTGGTCAAGGTATGATT
AAGTCAGATTTCTTTGTAATTAACAAAACTGATTTAGCTCCCTATGTAGGTGCATCATTA
GAACAAATGGCTGAAGATACTAAAGTATTTCGTGGTAAACGTCCATTTACTTTTACTAAC
TTAAAAACCGACGAAGGTTTGGATGAAGTTATCGATTGGATTGAACGCGACACTTTACTC
AAAGGATTATCATAA60
120
180
240
300
360
420
480
540
600
615
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS12380 [old locus tag: SAUSA300_2243 ]
- symbol: SAUSA300_RS12380
- description: urease accessory protein UreG
- length: 204
- theoretical pI: 4.4618
- theoretical MW: 22344.4
- GRAVY: -0.115196
⊟Function[edit | edit source]
- TIGRFAM: Central intermediary metabolism Nitrogen metabolism urease accessory protein UreG (TIGR00101; HMM-score: 313)and 10 moreProtein fate Protein modification and repair hydrogenase accessory protein HypB (TIGR00073; HMM-score: 85.9)Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides uridine kinase (TIGR00235; EC 2.7.1.48; HMM-score: 21.7)Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin cobalamin biosynthesis protein CobW (TIGR02475; HMM-score: 20.9)Unknown function General small GTP-binding protein domain (TIGR00231; HMM-score: 20.3)Transport and binding proteins Amino acids, peptides and amines LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 17.2)Regulatory functions Protein interactions LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 17.2)Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin molybdopterin-guanine dinucleotide biosynthesis protein B (TIGR00176; HMM-score: 13.6)Protein fate Protein and peptide secretion and trafficking putative secretion ATPase, PEP-CTERM locus subfamily (TIGR03015; HMM-score: 12.4)Protein fate Degradation of proteins, peptides, and glycopeptides ATP-dependent Clp protease ATP-binding subunit ClpA (TIGR02639; HMM-score: 10.9)DNA metabolism DNA replication, recombination, and repair orc1/cdc6 family replication initiation protein (TIGR02928; HMM-score: 10.6)
- TheSEED: see SAUSA300_2243
- PFAM: P-loop_NTPase (CL0023) cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 144.2)and 12 moreNTPase_1; NTPase (PF03266; HMM-score: 20.1)GTP_EFTU; Elongation factor Tu GTP binding domain (PF00009; HMM-score: 15.8)MobB; Molybdopterin guanine dinucleotide synthesis protein B (PF03205; HMM-score: 14.6)KAP_NTPase; KAP family P-loop domain (PF07693; HMM-score: 14.2)AAA_18; AAA domain (PF13238; HMM-score: 14.1)ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 13.7)MeaB; Methylmalonyl Co-A mutase-associated GTPase MeaB (PF03308; HMM-score: 13.4)RNA_helicase; RNA helicase (PF00910; HMM-score: 12.7)AAA_22; AAA domain (PF13401; HMM-score: 12.7)MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 12.2)TsaE; Threonylcarbamoyl adenosine biosynthesis protein TsaE (PF02367; HMM-score: 12)Zeta_toxin; Zeta toxin (PF06414; HMM-score: 11.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9606
- Cytoplasmic Membrane Score: 0.0319
- Cell wall & surface Score: 0
- Extracellular Score: 0.0075
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006482
- TAT(Tat/SPI): 0.000189
- LIPO(Sec/SPII): 0.000713
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 445925118 NCBI
- RefSeq: WP_000002973 NCBI
- UniProt: see SAUSA300_2243
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MANPIKIGIGGPVGAGKTQLIEKVVKRLSKEMSIGVITNDIYTKEDEKILVNSGVLPESRIIGVETGGCPHTAIREDASMNFAAIDELLERHDDIELIFIESGGDNLAATFSPELVDFSIYIIDVAQGEKIPRKGGQGMIKSDFFVINKTDLAPYVGASLEQMAEDTKVFRGKRPFTFTNLKTDEGLDEVIDWIERDTLLKGLS
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
SAUSA300_RS11505 (deoA) pyrimidine-nucleoside phosphorylase [1] (data from MRSA252) SAUSA300_RS10295 (gatA) glutamyl-tRNA(Gln) amidotransferase subunit A [1] (data from MRSA252) SAUSA300_RS01155 formate acetyltransferase [1] (data from MRSA252) SAUSA300_RS02635 cysteine synthase [1] (data from MRSA252) SAUSA300_RS02805 50S ribosomal protein L10 [1] (data from MRSA252) SAUSA300_RS02845 elongation factor G [1] (data from MRSA252) SAUSA300_RS02850 elongation factor Tu [1] (data from MRSA252) SAUSA300_RS03530 LysR family transcriptional regulator [1] (data from MRSA252) SAUSA300_RS04560 NADH dehydrogenase [1] (data from MRSA252) SAUSA300_RS04700 hypothetical protein [1] (data from MRSA252) SAUSA300_RS04905 enoyl-ACP reductase [1] (data from MRSA252) SAUSA300_RS05190 bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase [1] (data from MRSA252) SAUSA300_RS05350 pyruvate dehydrogenase E1 component subunit alpha [1] (data from MRSA252) SAUSA300_RS05360 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex [1] (data from MRSA252) SAUSA300_RS05365 dihydrolipoyl dehydrogenase [1] (data from MRSA252) SAUSA300_RS05855 cell division protein FtsZ [1] (data from MRSA252) SAUSA300_RS06135 50S ribosomal protein L19 [1] (data from MRSA252) SAUSA300_RS06220 30S ribosomal protein S2 [1] (data from MRSA252) SAUSA300_RS07140 undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase [1] (data from MRSA252) SAUSA300_RS08975 pyruvate kinase [1] (data from MRSA252) SAUSA300_RS09040 universal stress protein UspA [1] (data from MRSA252) SAUSA300_RS11380 uracil phosphoribosyltransferase [1] (data from MRSA252) SAUSA300_RS11805 Asp23/Gls24 family envelope stress response protein [1] (data from MRSA252) SAUSA300_RS11985 30S ribosomal protein S9 [1] (data from MRSA252) SAUSA300_RS12065 30S ribosomal protein S5 [1] (data from MRSA252) SAUSA300_RS12075 50S ribosomal protein L6 [1] (data from MRSA252) SAUSA300_RS12125 50S ribosomal protein L22 [1] (data from MRSA252) SAUSA300_RS12135 50S ribosomal protein L2 [1] (data from MRSA252) SAUSA300_RS12455 hypothetical protein [1] (data from MRSA252) SAUSA300_RS13745 pyruvate oxidase [1] (data from MRSA252) SAUSA300_RS13795 hydroxymethylglutaryl-CoA synthase [1] (data from MRSA252) SAUSA300_RS14105 malate:quinone oxidoreductase [1] (data from MRSA252) SAUSA300_RS14295 arginine deiminase [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)