Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS13600 [old locus tag: SAUSA300_2452 ]
- pan locus tag?: SAUPAN006149000
- symbol: SAUSA300_RS13600
- pan gene symbol?: —
- synonym:
- product: MarR family transcriptional regulator
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS13600 [old locus tag: SAUSA300_2452 ]
- symbol: SAUSA300_RS13600
- product: MarR family transcriptional regulator
- replicon: chromosome
- strand: -
- coordinates: 2648552..2649010
- length: 459
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (2648552..2649010) NCBI
- BioCyc: SAUSA300_RS13600 BioCyc
- MicrobesOnline: see SAUSA300_2452
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAAGAGAGAAGTTATTTTAAAATTACAACAATTTATTATAGAAAGAGAAAATGCCGAT
AAAAGAAGACAGTATAAAAAGGAAAATGAGGAACTAGATTTATCTCTAACACAATTTCAT
ATCATAGAGTTGATTGATAATAATGATAAAGTGAATAATAAATTTTTGTCTGAAATGTTA
AATGTATCAAAACCAGCAATTACTAAATCGATAAAAAAACTTTTAGCGAAAGACTTAGTA
GTTGAATCGCACAATGAATTTAACAAAAGAGAAGTTAATTATTCATTAACACAAAAAGGA
AAAAAATTATCTTATATACATGATGAATTACATGAAAAATCGGTAAAAAAATATGAAGAG
GTACTTAAAGTCTTTGATGATGATGAAATGGCAGTTATTATAGAGTTTTTAAACCGTAGT
ATAGAAGAATTAAAAAAAGAAGATGGTTTAAATGATTAA60
120
180
240
300
360
420
459
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS13600 [old locus tag: SAUSA300_2452 ]
- symbol: SAUSA300_RS13600
- description: MarR family transcriptional regulator
- length: 152
- theoretical pI: 6.15058
- theoretical MW: 18079.6
- GRAVY: -0.765789
⊟Function[edit | edit source]
- TIGRFAM: homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 39.9)and 7 moreRegulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 20.5)mobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 20.5)EPS-associated transcriptional regulator, MarR family (TIGR04176; HMM-score: 17.2)Biosynthesis of cofactors, prosthetic groups, and carriers Other iron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 16.5)Regulatory functions DNA interactions iron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 16.5)Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 15.2)Regulatory functions DNA interactions transcriptional regulator, Acidobacterial, PadR-family (TIGR03433; HMM-score: 14.7)
- TheSEED: see SAUSA300_2452
- PFAM: HTH (CL0123) MarR; MarR family (PF01047; HMM-score: 47.7)and 17 moreMarR_2; MarR family (PF12802; HMM-score: 34.9)HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 31.7)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 29.2)Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 27.3)Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 26.6)HxlR; HxlR-like helix-turn-helix (PF01638; HMM-score: 24.8)HTH_11; HTH domain (PF08279; HMM-score: 23.9)HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 23.2)HTH_45; Winged helix-turn-helix (PF14947; HMM-score: 19)TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 15.6)SMC_ScpB; Segregation and condensation complex subunit ScpB (PF04079; HMM-score: 15.2)Phage_rep_O; Bacteriophage replication protein O (PF04492; HMM-score: 14.4)HTH_DeoR; DeoR-like helix-turn-helix domain (PF08220; HMM-score: 13.9)GntR; Bacterial regulatory proteins, gntR family (PF00392; HMM-score: 13.2)no clan defined TINF2_N; TERF1-interacting nuclear factor 2 N-terminus (PF14973; HMM-score: 12.2)DUF763; Protein of unknown function (DUF763) (PF05559; HMM-score: 10.1)SieB; Super-infection exclusion protein B (PF14163; HMM-score: 7.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9288
- Cytoplasmic Membrane Score: 0.0052
- Cell wall & surface Score: 0.001
- Extracellular Score: 0.065
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006685
- TAT(Tat/SPI): 0.000219
- LIPO(Sec/SPII): 0.00043
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: see SAUSA300_2452
- RefSeq: WP_001803115 NCBI
- UniProt: see SAUSA300_2452
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKREVILKLQQFIIERENADKRRQYKKENEELDLSLTQFHIIELIDNNDKVNNKFLSEMLNVSKPAITKSIKKLLAKDLVVESHNEFNKREVNYSLTQKGKKLSYIHDELHEKSVKKYEEVLKVFDDDEMAVIIEFLNRSIEELKKEDGLND
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]