From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS02540 [old locus tag: SA0441 ]
  • pan locus tag?: SAUPAN002217000
  • symbol: SA_RS02540
  • pan gene symbol?: darA
  • synonym: pstA
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS02540 [old locus tag: SA0441 ]
  • symbol: SA_RS02540
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 514185..514514
  • length: 330
  • essential: no DEG other strains

Accession numbers[edit | edit source]

  • Location: NC_002745 (514185..514514) NCBI
  • BioCyc: SA_RS02540 BioCyc
  • MicrobesOnline: see SA0441

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAAAATGATTATAGCGATCGTACAAGATCAAGATAGTCAGGAACTTGCAGATCAACTT
    GTTAAAAATAACTTTAGAGCAACAAAATTGGCAACAACAGGTGGGTTTTTAAGAGCGGGT
    AATACAACATTCTTATGTGGTGTCAATGATGACCGTGTAGATGAAATATTGTCTGTGATT
    AATCAAACGTGTGGTAATAGAGAACAGTTGGTTTCACCTATTACACCTATGGGAGGCAGT
    GCGGATTCGTACATTCCATATCCAGTTGAAGTTGAAGTTGGCGGTGCTACTGTATTTGTT
    ATGCCAGTTGATGCATTCCATCAATTTTAA
    60
    120
    180
    240
    300
    330


Protein[edit | edit source]

Protein Data Bank: 4WK1
Protein Data Bank: 4WK3
Protein Data Bank: 4D3G
Protein Data Bank: 4D3H

General[edit | edit source]

  • locus tag: SA_RS02540 [old locus tag: SA0441 ]
  • symbol: SA_RS02540
  • description: hypothetical protein
  • length: 109
  • theoretical pI: 4.21092
  • theoretical MW: 11838.4
  • GRAVY: 0.0422018

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SA0441
  • PFAM:
    GlnB-like (CL0089) CdAMP_rec; Cyclic-di-AMP receptor (PF06153; HMM-score: 183.4)
    and 1 more
    P-II; Nitrogen regulatory protein P-II (PF00543; HMM-score: 16.4)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9792
    • Cytoplasmic Membrane Score: 0.0095
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0112
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.047234
    • TAT(Tat/SPI): 0.008151
    • LIPO(Sec/SPII): 0.00179
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MKMIIAIVQDQDSQELADQLVKNNFRATKLATTGGFLRAGNTTFLCGVNDDRVDEILSVINQTCGNREQLVSPITPMGGSADSYIPYPVEVEVGGATVFVMPVDAFHQF

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]