PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

⊟Summary

• organism: Staphylococcus aureus N315
• locus tag: SA_RS06585 [old locus tag: SAS041 ]
• pan locus tag^?: SAUPAN003692000
• symbol: SA_RS06585
• pan gene symbol^?: —
• synonym:
• product: hypothetical protein

⊟Genome View

⊟Gene

⊟General

• type: CDS
• locus tag: SA_RS06585 [old locus tag: SAS041 ]
• symbol: SA_RS06585
• product: hypothetical protein
• replicon: chromosome
• strand: -
• coordinates: 1321100..1321288
• length: 189
• essential: no DEG other strains

⊟Accession numbers

• Location: NC_002745 (1321100..1321288) NCBI
• BioCyc: SA_RS06585 BioCyc
• MicrobesOnline: see SAS041

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  121
  181
  
  ATGAACATTTCAAATGAAAATACAGTCACATTAATTGCAGTAATTATCGCAATTATCATT
  GGTATTTTCCTACAAATATTTTTCAAATTACCATTAATAGTGACGGCAGTACTATCTATT
  TTATTGGGTATCTTTGTAGGCTTTATCGTTTACTTGATTGTTTCGTTTTATAATAAGCGA
  AAAAATTAG
  60
  120
  180
  189
  

⊟Protein

⊟General

• locus tag: SA_RS06585 [old locus tag: SAS041 ]
• symbol: SA_RS06585
• description: hypothetical protein
• length: 62
• theoretical pI: 10.3273
• theoretical MW: 6956.53
• GRAVY: 1.55323

⊟Function

• TIGRFAM:
  Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids MFS transporter, sugar porter (SP) family (TIGR00879; HMM-score: 12.5)
  Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids bile acid transporter (TIGR00841; HMM-score: 11.5)
  and 4 more
  cxxc_20_cxxc protein (TIGR04104; HMM-score: 8.3)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking type VII secretion protein EssA (TIGR03927; HMM-score: 7.5)
  chain length determinant protein EpsF (TIGR03017; HMM-score: 6.8)
  cobalt transporter subunit CbtB (proposed) (TIGR02459; HMM-score: 6.2)
• TheSEED: see SAS041
• PFAM:
  no clan defined DUF4396; Domain of unknown function (DUF4396) (PF14342; HMM-score: 18.3)
  BPD_transp_1 (CL0404) FtsX; FtsX-like permease C-terminal (PF02687; HMM-score: 15.2)
  no clan defined DUF2613; Protein of unknown function (DUF2613) (PF11021; HMM-score: 14.8)
  and 18 more
  DUF2583; Protein of unknown function (DUF2583) (PF10762; HMM-score: 13.9)
  Apoptosis-Inhib (CL0453) Bax1-I; Inhibitor of apoptosis-promoting Bax1 (PF01027; HMM-score: 13)
  no clan defined RseC_MucC; Positive regulator of sigma(E), RseC/MucC (PF04246; HMM-score: 12.9)
  DUF6404; Family of unknown function (DUF6404) (PF19942; HMM-score: 12.5)
  DUF1576; Protein of unknown function (DUF1576) (PF07613; HMM-score: 11.9)
  DUF4191; Domain of unknown function (DUF4191) (PF13829; HMM-score: 11)
  DUF973; Protein of unknown function (DUF973) (PF06157; HMM-score: 10.9)
  MFS (CL0015) Sugar_tr; Sugar (and other) transporter (PF00083; HMM-score: 10.3)
  no clan defined Myc_target_1; Myc target protein 1 (PF15179; HMM-score: 10.3)
  Halogen_Hydrol; 5-bromo-4-chloroindolyl phosphate hydrolysis protein (PF10112; HMM-score: 10.1)
  DUF4407; Domain of unknown function (DUF4407) (PF14362; HMM-score: 9.2)
  DUF6418; Family of unknown function (DUF6418) (PF19982; HMM-score: 9.2)
  TM_ErbB1; Epidermal growth factor receptor transmembrane-juxtamembrane segment (PF21314; HMM-score: 9.1)
  Holin-II (CL0563) Phage_holin_2_1; Bacteriophage P21 holin S (PF04971; HMM-score: 8.8)
  no clan defined DUF2070; Predicted membrane protein (DUF2070) (PF09843; HMM-score: 8.5)
  DUF2207_C; Predicted membrane protein (DUF2207) C-terminal domain (PF20990; HMM-score: 8.1)
  LapA_dom; Lipopolysaccharide assembly protein A domain (PF06305; HMM-score: 7.4)
  FeoB_associated; FeoB-associated Cys-rich membrane protein (PF12669; HMM-score: 7)

⊟Structure, modifications & cofactors

• domains:
• modifications:
• cofactors:
• effectors:

⊟Localization

• PSORTb: Cytoplasmic Membrane
  • Cytoplasmic Score: 0.32
  • Cytoplasmic Membrane Score: 9.55
  • Cellwall Score: 0.12
  • Extracellular Score: 0.01
  • Internal Helices: 2
• DeepLocPro: Cytoplasmic Membrane
  • Cytoplasmic Score: 0.0001
  • Cytoplasmic Membrane Score: 0.8898
  • Cell wall & surface Score: 0.0002
  • Extracellular Score: 0.1099
• LocateP:
• SignalP: no predicted signal peptide
  • SP(Sec/SPI): 0.001472
  • TAT(Tat/SPI): 0.000247
  • LIPO(Sec/SPII): 0.052589
• predicted transmembrane helices (TMHMM): 2

⊟Accession numbers

• GI: 446949887 NCBI
• RefSeq: WP_001027143 NCBI
• UniProt: see SAS041

⊟Protein sequence

• MNISNENTVTLIAVIIAIIIGIFLQIFFKLPLIVTAVLSILLGIFVGFIVYLIVSFYNKRKN

⊟Experimental data

• experimentally validated:
• protein localization:
• quantitative data / protein copy number per cell:
• interaction partners:

⊟Expression & Regulation

⊟Operon

⊟Regulation

• regulator:

⊟Transcription pattern

• S.aureus Expression Data Browser: data available for NCTC8325

⊟Protein synthesis (provided by Aureolib)

• Aureolib: no data available

⊟Protein stability

• half-life: no data available

⊟Biological Material

⊟Mutants

⊟Expression vector

⊟lacZ fusion

⊟GFP fusion

⊟two-hybrid system

⊟FLAG-tag construct

⊟Antibody

⊟Other Information

You are kindly invited to share additional interesting facts.

⊟Literature

⊟References

⊟Relevant publications