From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS09460 [old locus tag: SA1674 ]
  • pan locus tag?: SAUPAN004793000
  • symbol: glnQ
  • pan gene symbol?: glnQ
  • synonym:
  • product: amino acid ABC transporter ATP-binding protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS09460 [old locus tag: SA1674 ]
  • symbol: glnQ
  • product: amino acid ABC transporter ATP-binding protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1910731..1911459
  • length: 729
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_002745 (1910731..1911459) NCBI
  • BioCyc: SA_RS09460 BioCyc
  • MicrobesOnline: see SA1674

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGCCAGTGATTAAAATAAACAATCTTAATAAAGTTTTTGGAGATAATGAAGTTTTAAAA
    GATATCAATCTTGAAATCAATCAAGGGGAAGTAGTAGCAATAATAGGTCCATCTGGTAGT
    GGTAAAAGTACATTGTTAAGATGTATGAATTTATTAGAAGTACCCACTAAAGGTCAAGTG
    ATTTTTGAAGGCAATGACTTAACGGAAAAAGGGACACAAGTAGATAAACTACGTCAAAAA
    ATGGGTATGGTATTTCAAAACTTCAACCTATTTCCACATAAAAAAGTTGTCGATAATATT
    ATTTTAGCTCCTAAATTATTAAAGAAAGATAATAACGATGAATTACATAAGGAAGCATTG
    TCGTTATTAGATAAAGTGGGATTAAAAGAAAAAGCAGATGTATATCCGAATCAATTATCA
    GGTGGTCAAAAGCAAAGGGTTGCAATTGCAAGAGCTTTAGCAATGCATCCAGATGTTATT
    TTATTCGATGAACCAACTTCAGCATTAGATCCTGAGGTAGTTGGTGATGTATTAAAAGTA
    ATGAAAGACCTAGCCAAAGAAGGTATGACCATGGTGGTTGTGACACATGAAATGGGATTT
    GCCAAAGATGTAAGTGACAAAGTCATATTTATGGCAGATGGCGTTGTCGTAGAGTCAGGC
    ACACCAGTCGAAATATTTGAACAACCGCAACATGAAAGAACACAAAATTTCTTAGCAAGA
    GTATTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    729

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SA_RS09460 [old locus tag: SA1674 ]
  • symbol: GlnQ
  • description: amino acid ABC transporter ATP-binding protein
  • length: 242
  • theoretical pI: 5.70084
  • theoretical MW: 26768
  • GRAVY: -0.120248

⊟Function[edit | edit source]

  • TIGRFAM:
    ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 292.9)
    Metabolism Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 273.3)
    and 79 more
    D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 232.2)
    Metabolism Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 226.2)
    Metabolism Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 220.1)
    Metabolism Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 218.9)
    Metabolism Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 215)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 199.6)
    Cellular processes Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 197.3)
    ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 195.7)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 194.9)
    Cellular processes Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 189)
    Metabolism Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 189)
    2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 185.1)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 182.7)
    Metabolism Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 173.2)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 162.3)
    Metabolism Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 161.2)
    Metabolism Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 158.3)
    Metabolism Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 157.1)
    Metabolism Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 157.1)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 156.9)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 155.6)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 155.6)
    Cellular processes Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 149.2)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 149.2)
    Metabolism Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 148.3)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 145.6)
    Metabolism Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 145.4)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 145.1)
    Metabolism Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 143.9)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 143.8)
    Metabolism Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 143.8)
    Metabolism Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 138.9)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 138.2)
    Metabolism Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 138.2)
    thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 137.3)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 133.8)
    Metabolism Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 132.9)
    ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 132.1)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 129.1)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 129.1)
    proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 128.5)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 125.1)
    thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 123.1)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 119)
    gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 115)
    Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 114.9)
    lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 114.6)
    Metabolism Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 111.5)
    Cellular processes Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 109.7)
    Metabolism Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 109.7)
    phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 108.9)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 106.8)
    Metabolism Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 106.5)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 106.2)
    Genetic information processing Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 106.2)
    Metabolism Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 106.2)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 102.8)
    Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 102.8)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 98.1)
    Metabolism Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 94.1)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 93.2)
    ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 92)
    Metabolism Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 83.9)
    Metabolism Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 83.9)
    Metabolism Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 76.2)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 57.7)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 56)
    Metabolism Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 50.1)
    Metabolism Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 48.6)
    rad50 (TIGR00606; HMM-score: 17)
    Metabolism Central intermediary metabolism Phosphorus compounds phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN (TIGR02322; HMM-score: 15.7)
    Cellular processes Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 15.1)
    Genetic information processing DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 15.1)
    KaiC domain protein, PAE1156 family (TIGR03881; HMM-score: 14)
    Unknown function General Mg chelatase-like protein (TIGR00368; HMM-score: 13.1)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin molybdopterin-guanine dinucleotide biosynthesis protein B (TIGR00176; HMM-score: 12.9)
    Cell structure Cell envelope Surface structures twitching motility protein (TIGR01420; HMM-score: 12.7)
    Cellular processes Cellular processes Chemotaxis and motility twitching motility protein (TIGR01420; HMM-score: 12.7)
    type IV secretion/conjugal transfer ATPase, VirB4 family (TIGR00929; HMM-score: 12.4)
  • TheSEED: see SA1674
  • PFAM:
    P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 133.3)
    and 30 more
    AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 51.4)
    SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 43.9)
    AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 27.8)
    ABC_ATPase; Predicted ATPase of the ABC class (PF09818; HMM-score: 24.3)
    AAA_23; AAA domain (PF13476; HMM-score: 23.7)
    AAA_15; AAA ATPase domain (PF13175; HMM-score: 21.8)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 21.2)
    AAA_22; AAA domain (PF13401; HMM-score: 20)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 18.8)
    AAA_30; AAA domain (PF13604; HMM-score: 16.3)
    AAA_13; AAA domain (PF13166; HMM-score: 15.8)
    AAA_18; AAA domain (PF13238; HMM-score: 15.7)
    ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 15.5)
    AAA_24; AAA domain (PF13479; HMM-score: 14.9)
    AAA_25; AAA domain (PF13481; HMM-score: 14.9)
    AAA_33; AAA domain (PF13671; HMM-score: 14.9)
    Mg_chelatase; Magnesium chelatase, subunit ChlI (PF01078; HMM-score: 14.3)
    Adeno_IVa2; Adenovirus IVa2 protein (PF02456; HMM-score: 14)
    MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 13.9)
    IstB_IS21; IstB-like ATP binding protein (PF01695; HMM-score: 13.7)
    SbcCD_C; Putative exonuclease SbcCD, C subunit (PF13558; HMM-score: 13.4)
    AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 13.3)
    G-alpha; G-protein alpha subunit (PF00503; HMM-score: 13)
    AAA_19; AAA domain (PF13245; HMM-score: 13)
    NACHT; NACHT domain (PF05729; HMM-score: 12.9)
    AAA_28; AAA domain (PF13521; HMM-score: 12.8)
    T2SSE; Type II/IV secretion system protein (PF00437; HMM-score: 12.4)
    Cytidylate_kin; Cytidylate kinase (PF02224; HMM-score: 12.4)
    NB-ARC; NB-ARC domain (PF00931; HMM-score: 11.9)
    CYTH (CL0273) Pox_ATPase-GT; mRNA capping enzyme N-terminal, ATPase and guanylyltransferase (PF10640; HMM-score: 11.6)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.05
    • Cytoplasmic Membrane Score: 8.78
    • Cellwall Score: 0.08
    • Extracellular Score: 0.09
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002863
    • TAT(Tat/SPI): 0.000169
    • LIPO(Sec/SPII): 0.000221
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MPVIKINNLNKVFGDNEVLKDINLEINQGEVVAIIGPSGSGKSTLLRCMNLLEVPTKGQVIFEGNDLTEKGTQVDKLRQKMGMVFQNFNLFPHKKVVDNIILAPKLLKKDNNDELHKEALSLLDKVGLKEKADVYPNQLSGGQKQRVAIARALAMHPDVILFDEPTSALDPEVVGDVLKVMKDLAKEGMTMVVVTHEMGFAKDVSDKVIFMADGVVVESGTPVEIFEQPQHERTQNFLARVL

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:
    SA_RS02960elongation factor Tu  [1] (data from MRSA252)
    SA_RS0622530S ribosomal protein S2  [1] (data from MRSA252)
    SA_RS08560pyruvate kinase  [1] (data from MRSA252)
    SA_RS1160030S ribosomal protein S9  [1] (data from MRSA252)
    SA_RS1168030S ribosomal protein S5  [1] (data from MRSA252)
    SA_RS1169050S ribosomal protein L6  [1] (data from MRSA252)

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: ArgR*, CodY see SA1674

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ 1.0 1.1 1.2 1.3 1.4 1.5 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SA_RS09460&oldid=95699"