From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS13355 [old locus tag: SA2330 ]
  • pan locus tag?: SAUPAN006199000
  • symbol: SA_RS13355
  • pan gene symbol?: cidR
  • synonym:
  • product: LysR family transcriptional regulator

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS13355 [old locus tag: SA2330 ]
  • symbol: SA_RS13355
  • product: LysR family transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 2614999..2615862
  • length: 864
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_002745 (2614999..2615862) NCBI
  • BioCyc: G1G21-2712 BioCyc
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGAAATATTTTATTGAAGTCGTTAAGCAAGGAGGCATGACTAATGCCTCCAAATCATTA
    TATATTGCACAACCTACAATTAGTAAAGCAATTAAAGATATTGAAAATGAAATGGGCACG
    CCCTTATTTGATAGAAGTAAAAGACATTTAATACTTACCGATGCAGGTCAAATTTTTTAT
    GAGAAAAGTAAAGAAATTGTTGCACTGTATGATTATTTACCATCTGAAATGGAACGCTTG
    AATGGACTGGAAACAGGGCATATAAACATGGGCATGTCGGCAGTCATGAATATGAAGATT
    CTTATCAATATTCTTGGTGCATTCCATCAGCAATATCCAAATGTTACATATAATTTAATA
    GAAAATGGCGGCAAAACGATTGAGCAGCAAATTATCAATGATGAAGTAGATATAGGCGTG
    ACCACTTTGCCAGTCGATCATCATATTTTCGATTATACTACCCTAGATAAGGAAGATTTG
    CGACTTATCGTGAGCAGAGAGCATCGACTCGCAAAATATGAAACTGTTAAACTCGAAGAT
    TTAGCAGGTGAAGACTTCATTTTATTTAATAAAGACTTTTACTTGAATGATAAAATTATT
    GAAAATGCTAAAAACGTTGGCTTTGTTCCGAATACTGTAGCGCAAATTTCACAATGGCAT
    GTTATAGAAGATTTAGTTACGAATGAATTAGGTATTAGTATTTTACCAACATCAATTTCA
    GAGCAACTAAATGGAGATGTGAAGCTGCTACGCATTGAAGATGCGCATGTACATTGGGAA
    TTAGGTGTTGTTTGGAAGAAGGATAAACAATTAAGTCATGCCACAACGAAATGGATAGAA
    TTTTTGAAAGATCGTTTAGGCTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    864

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS13355 [old locus tag: SA2330 ]
  • symbol: SA_RS13355
  • description: LysR family transcriptional regulator
  • length: 287
  • theoretical pI: 5.22208
  • theoretical MW: 32846.4
  • GRAVY: -0.225784

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions aminoethylphosphonate catabolism associated LysR family transcriptional regulator (TIGR03339; HMM-score: 131.4)
    and 8 more
    Metabolism Energy metabolism Other pca operon transcription factor PcaQ (TIGR02424; HMM-score: 82.9)
    Signal transduction Regulatory functions DNA interactions pca operon transcription factor PcaQ (TIGR02424; HMM-score: 82.9)
    putative choline sulfate-utilization transcription factor (TIGR03418; HMM-score: 53.7)
    Cellular processes Cellular processes Toxin production and resistance transcriptional regulator, ArgP family (TIGR03298; HMM-score: 41.3)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair transcriptional regulator, ArgP family (TIGR03298; HMM-score: 41.3)
    Signal transduction Regulatory functions DNA interactions transcriptional regulator, ArgP family (TIGR03298; HMM-score: 41.3)
    Signal transduction Regulatory functions DNA interactions D-serine deaminase transcriptional activator (TIGR02036; HMM-score: 33.9)
    Metabolism Fatty acid and phospholipid metabolism Biosynthesis poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit (TIGR01836; HMM-score: 15.1)
  • TheSEED:
  • PFAM:
    PBP (CL0177) LysR_substrate; LysR substrate binding domain (PF03466; HMM-score: 143.8)
    and 2 more
    HTH (CL0123) HTH_1; Bacterial regulatory helix-turn-helix protein, lysR family (PF00126; HMM-score: 64.4)
    no clan defined ERp29; Endoplasmic reticulum protein ERp29, C-terminal domain (PF07749; HMM-score: 13.1)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.007355
    • TAT(Tat/SPI): 0.000552
    • LIPO(Sec/SPII): 0.001499
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_001549809 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MKYFIEVVKQGGMTNASKSLYIAQPTISKAIKDIENEMGTPLFDRSKRHLILTDAGQIFYEKSKEIVALYDYLPSEMERLNGLETGHINMGMSAVMNMKILINILGAFHQQYPNVTYNLIENGGKTIEQQIINDEVDIGVTTLPVDHHIFDYTTLDKEDLRLIVSREHRLAKYETVKLEDLAGEDFILFNKDFYLNDKIIENAKNVGFVPNTVAQISQWHVIEDLVTNELGISILPTSISEQLNGDVKLLRIEDAHVHWELGVVWKKDKQLSHATTKWIEFLKDRLG

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]