From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS00075 [old locus tag: NWMN_0014 ]
  • pan locus tag?: SAUPAN000025000
  • symbol: NWMN_RS00075
  • pan gene symbol?: rplI
  • synonym:
  • product: 50S ribosomal protein L9

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS00075 [old locus tag: NWMN_0014 ]
  • symbol: NWMN_RS00075
  • product: 50S ribosomal protein L9
  • replicon: chromosome
  • strand: +
  • coordinates: 20289..20735
  • length: 447
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (20289..20735) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAAAGTAATTTTTACACAAGATGTTAAAGGTAAAGGTAAAAAAGGTGAAGTTAAAGAA
    GTACCAGTAGGTTATGCAAATAACTTCTTATTGAAAAAGAATTATGCTGTAGAAGCAACA
    CCAGGTAACCTTAAACAATTAGAGTTACAGAAAAAACGTGCAAAACAAGAACGCCAACAA
    GAAATTGAAGATGCTAAAGCATTAAAAGAAACGTTATCAAACATTGAAGTTGAAGTATCA
    GCAAAAACTGGTGAAGGTGGTAAATTGTTTGGGTCAGTAAGTACAAAACAAATTGCCGAA
    GCACTAAAAGCACAACATGATATTAAAATTGATAAACGTAAAATGGATTTACCAAATGGA
    ATTCATTCCCTAGGATATACGAATGTACCTGTTAAATTAGATAAAGAAGTTGAAGGTACA
    ATTCGCGTACACACAGTTGAACAATAA
    60
    120
    180
    240
    300
    360
    420
    447

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS00075 [old locus tag: NWMN_0014 ]
  • symbol: NWMN_RS00075
  • description: 50S ribosomal protein L9
  • length: 148
  • theoretical pI: 10.0654
  • theoretical MW: 16453.8
  • GRAVY: -0.681757

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein bL9 (TIGR00158; HMM-score: 149.7)
  • TheSEED:
  • PFAM:
    no clan definedRibosomal_L9_C; Ribosomal protein L9, C-terminal domain (PF03948; HMM-score: 98.6)
    Ribosomal_L9_N; Ribosomal protein L9, N-terminal domain (PF01281; HMM-score: 78.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    NWMN_RS02420ABC transporter substrate-binding protein  [1] (data from MRSA252)
    NWMN_RS0291050S ribosomal protein L11  [1] (data from MRSA252)
    NWMN_RS0292050S ribosomal protein L10  [1] (data from MRSA252)
    NWMN_RS03640LysR family transcriptional regulator  [1] (data from MRSA252)
    NWMN_RS08930pyruvate kinase  [1] (data from MRSA252)
    NWMN_RS1242050S ribosomal protein L4  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.145
    • Ymax_pos: 12
    • Cmax: 0.116
    • Cmax_pos: 39
    • Smax: 0.233
    • Smax_pos: 6
    • Smean: 0.194
    • D: 0.164
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446787049 NCBI
  • RefSeq: WP_000864305 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKVIFTQDVKGKGKKGEVKEVPVGYANNFLLKKNYAVEATPGNLKQLELQKKRAKQERQQEIEDAKALKETLSNIEVEVSAKTGEGGKLFGSVSTKQIAEALKAQHDIKIDKRKMDLPNGIHSLGYTNVPVKLDKEVEGTIRVHTVEQ

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS00075 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.0 1.1 1.2 1.3 1.4 1.5 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]