NCBI: 02-MAR-2017

⊟Summary

• organism: Staphylococcus aureus Newman
• locus tag: NWMN_RS01185 [old locus tag: NWMN_0211 ]
• pan locus tag^?: SAUPAN001164000
• symbol: NWMN_RS01185
• pan gene symbol^?: —
• synonym:
• product: ABC transporter ATP-binding protein

⊟Gene

⊟General

• type: CDS
• locus tag: NWMN_RS01185 [old locus tag: NWMN_0211 ]
• symbol: NWMN_RS01185
• product: ABC transporter ATP-binding protein
• replicon: chromosome
• strand: -
• coordinates: 268732..269391
• length: 660
• essential: unknown

⊟Accession numbers

• Location: NC_009641 (268732..269391) NCBI
• MicrobesOnline:

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  121
  181
  241
  301
  361
  421
  481
  541
  601
  
  ATGATAGAAATTAATAACCTTTCAAAGCGTTACCGTAACAAACAGATTTTCAATCATTTA
  ACTATGTCCTTTGATAGTAATCGTTTAACCGTATTACTTGGTGATAATGGTGCTGGAAAA
  TCAACATTACTTCGTATGATTGCTGGTATTGAAAAAGCTAATGATGGAACTATCAACTAT
  TTCGGCGAAAAATGGAATCAAAGACAAATACAAAATCACATCGGTTATGTGCCACAAGAC
  ATTGCGTTATTTGAACACATGACAGTGGCTGAAAACATTAAATTTTTTAAATCACTTTGT
  AAAAATCCAATTAACGATACAACTATCAACGAATATTTACAGCAATTAAACTTTGATGAT
  ACGTCTGCCAAAGTATCTACATTGTCCGGTGGGAATAAACGTAAAATTAATATATTAGTA
  GGTTTACTAGGTCAACCTCGAATTCTCATTTTAGATGAACCGACAGTTGGTATTGATTTA
  AAATCTAGACATGACATCCACCAACTACTTAACATCATGAAATCTAAATGTTTAATTATA
  TTAACTACCCATCATTTAGATGAAGTTGAAGCACTTGCAGATGATATCAAGTTAATTGGC
  CAAGATCCTTTTTATCAACATGTTTTAGAGGACAAACAATGGACTTATACCTATTATTAA
  60
  120
  180
  240
  300
  360
  420
  480
  540
  600
  660
  

⊟Protein

⊟General

• locus tag: NWMN_RS01185 [old locus tag: NWMN_0211 ]
• symbol: NWMN_RS01185
• description: ABC transporter ATP-binding protein
• length: 219
• theoretical pI: 7.27079
• theoretical MW: 25161.7
• GRAVY: -0.33105

⊟Function

• reaction:
• TIGRFAM:
  MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 143.2)
  lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 136.3)
  MetabolismTransport and binding proteinsOtherdaunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 135.2)
  MetabolismTransport and binding proteinsAnionssulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 124.5)
  Cellular processesCellular processesToxin production and resistanceputative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 121.2)
  MetabolismTransport and binding proteinsUnknown substrateputative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 121.2)
  Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesLPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 115)
  MetabolismTransport and binding proteinsOtherLPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 115)
  gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 114.3)
  MetabolismTransport and binding proteinsAmino acids, peptides and aminesurea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 114.2)
  Genetic information processingProtein fateProtein and peptide secretion and traffickingheme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 109.3)
  MetabolismTransport and binding proteinsOtherheme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 109.3)
  Cellular processesCellular processesOthernodulation ABC transporter NodI (TIGR01288; HMM-score: 108.4)
  MetabolismTransport and binding proteinsOthernodulation ABC transporter NodI (TIGR01288; HMM-score: 108.4)
  MetabolismTransport and binding proteinsAnionsmolybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 106.9)
  MetabolismTransport and binding proteinsUnknown substrateenergy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 105.8)
  MetabolismTransport and binding proteinsOtherrim ABC transporter (TIGR01257; HMM-score: 104.4)
  Cellular processesCellular processesCell divisioncell division ATP-binding protein FtsE (TIGR02673; HMM-score: 103.5)
  MetabolismTransport and binding proteinsAmino acids, peptides and aminesputative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 101.7)
  MetabolismTransport and binding proteinsAmino acids, peptides and aminespolyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 99.2)
  thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 98.3)
  MetabolismTransport and binding proteinsUnknown substrateenergy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 95.9)
  2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 92.4)
  MetabolismTransport and binding proteinsAnionsphosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 91.3)
  MetabolismTransport and binding proteinsAnionsphosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 91.1)
  Genetic information processingProtein fateProtein and peptide secretion and traffickingtype I secretion system ATPase (TIGR01842; HMM-score: 90.7)
  ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 90.5)
  MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsD-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 88.7)
  MetabolismTransport and binding proteinsAmino acids, peptides and aminesurea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 88.2)
  Cellular processesCellular processesPathogenesistype I secretion system ATPase (TIGR03375; HMM-score: 87.5)
  Genetic information processingProtein fateProtein and peptide secretion and traffickingtype I secretion system ATPase (TIGR03375; HMM-score: 87.5)
  proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 87.2)
  ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 85.3)
  MetabolismTransport and binding proteinsCations and iron carrying compoundscobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 81.2)
  MetabolismTransport and binding proteinsOtherpigment precursor permease (TIGR00955; HMM-score: 80)
  Genetic information processingProtein fateProtein and peptide secretion and traffickinglipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 79.5)
  MetabolismTransport and binding proteinsAnionsnitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 79.1)
  MetabolismTransport and binding proteinsOthernitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 79.1)
  MetabolismTransport and binding proteinsOtherthiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 78.8)
  MetabolismTransport and binding proteinsAmino acids, peptides and aminesglycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 78.2)
  Cellular processesCellular processesBiosynthesis of natural productsNHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 77)
  MetabolismTransport and binding proteinsAmino acids, peptides and aminesNHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 77)
  thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 75.4)
  MetabolismTransport and binding proteinsUnknown substrateanchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 74.6)
  MetabolismTransport and binding proteinsCations and iron carrying compoundsnickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 69.2)
  ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 68.9)
  phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 66.9)
  Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharideslipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 65.5)
  MetabolismTransport and binding proteinsOtherlipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 65.5)
  MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtherFeS assembly ATPase SufC (TIGR01978; HMM-score: 63.1)
  Genetic information processingProtein fateProtein and peptide secretion and traffickingABC-type bacteriocin transporter (TIGR01193; HMM-score: 62.9)
  Genetic information processingProtein fateProtein modification and repairABC-type bacteriocin transporter (TIGR01193; HMM-score: 62.9)
  MetabolismTransport and binding proteinsOtherABC-type bacteriocin transporter (TIGR01193; HMM-score: 62.9)
  MetabolismTransport and binding proteinsOtherantigen peptide transporter 2 (TIGR00958; HMM-score: 62.8)
  D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 62.8)
  ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 62.2)
  Cellular processesCellular processesBiosynthesis of natural productsNHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 59.6)
  MetabolismTransport and binding proteinsAmino acids, peptides and aminesNHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 59.6)
  Genetic information processingProtein fateProtein and peptide secretion and traffickingtype I secretion system ATPase (TIGR01846; HMM-score: 53.4)
  MetabolismEnergy metabolismMethanogenesismethyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 52.7)
  MetabolismTransport and binding proteinsCations and iron carrying compoundsnickel import ATP-binding protein NikD (TIGR02770; HMM-score: 52.5)
  MetabolismTransport and binding proteinsOtherpleiotropic drug resistance family protein (TIGR00956; HMM-score: 49.3)
  MetabolismCentral intermediary metabolismPhosphorus compoundsphosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 48.3)
  MetabolismTransport and binding proteinsAmino acids, peptides and aminescholine ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 45.5)
  MetabolismTransport and binding proteinsAnionscystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 43.2)
  MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsglucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 36.3)
  MetabolismTransport and binding proteinsOthermulti drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 31.6)
  Genetic information processingDNA metabolismDNA replication, recombination, and repairexcinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 30.9)
  MetabolismTransport and binding proteinsAmino acids, peptides and aminescyclic peptide transporter (TIGR01194; HMM-score: 27.4)
  MetabolismTransport and binding proteinsOthercyclic peptide transporter (TIGR01194; HMM-score: 27.4)
  MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsperoxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 25.1)
  Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA repair protein RecN (TIGR00634; HMM-score: 15.3)
  Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA replication and repair protein RecF (TIGR00611; HMM-score: 13.3)
  Genetic information processingDNA metabolismOtherMutS2 family protein (TIGR01069; HMM-score: 13.1)
  Unknown functionGeneralsmall GTP-binding protein domain (TIGR00231; HMM-score: 12.7)
  flagellar protein export ATPase FliI (TIGR03498; EC 3.6.3.14; HMM-score: 12.3)
  Cellular processesCellular processesChemotaxis and motilityflagellar protein export ATPase FliI (TIGR03497; EC 3.6.3.14; HMM-score: 12)
  Cellular processesCellular processesChemotaxis and motilityflagellar protein export ATPase FliI (TIGR03496; EC 3.6.3.14; HMM-score: 11.6)
  MetabolismEnergy metabolismATP-proton motive force interconversionATPase, FliI/YscN family (TIGR01026; EC 3.6.3.14; HMM-score: 11.4)
  Genetic information processingProtein fateProtein and peptide secretion and traffickingtype VII secretion protein EccCb (TIGR03925; HMM-score: 11.2)
• TheSEED:
• PFAM:
  P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 110.1)
  AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 44.6)
  AAA_23; AAA domain (PF13476; HMM-score: 32.2)
  AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 25.5)
  RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 21.8)
  SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 20.3)
  AAA_15; AAA ATPase domain (PF13175; HMM-score: 19.6)
  AAA_16; AAA ATPase domain (PF13191; HMM-score: 19.1)
  AAA_30; AAA domain (PF13604; HMM-score: 18)
  AAA_13; AAA domain (PF13166; HMM-score: 16.5)
  AAA_27; AAA domain (PF13514; HMM-score: 16)
  G-alpha; G-protein alpha subunit (PF00503; HMM-score: 15.3)
  NACHT; NACHT domain (PF05729; HMM-score: 14.8)
  DLIC; Dynein light intermediate chain (DLIC) (PF05783; HMM-score: 14.7)
  AAA_22; AAA domain (PF13401; HMM-score: 14.1)
  ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 12.8)
  Roc; Ras of Complex, Roc, domain of DAPkinase (PF08477; HMM-score: 12.7)
  MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 12.6)
  NTPase_1; NTPase (PF03266; HMM-score: 12.5)
  SbcCD_C; Putative exonuclease SbcCD, C subunit (PF13558; HMM-score: 11.9)
  PhoH; PhoH-like protein (PF02562; HMM-score: 11.7)

⊟Structure, modifications & interactions

• domains:
• modifications:
• cofactors:
• effectors:
• protein partners:

⊟Localization

• PSORTb: Cytoplasmic Membrane
  • Cytoplasmic Score: 1.05
  • Cytoplasmic Membrane Score: 8.78
  • Cellwall Score: 0.08
  • Extracellular Score: 0.09
  • Internal Helices: 0
• LocateP:
• SignalP: no predicted signal peptide
  • Ymax: 0.151
  • Ymax_pos: 14
  • Cmax: 0.13
  • Cmax_pos: 54
  • Smax: 0.287
  • Smax_pos: 6
  • Smean: 0.229
  • D: 0.182
• predicted transmembrane helices (TMHMM): 0

⊟Accession numbers

• GI: 446492217 NCBI
• RefSeq: WP_000570071 NCBI
• UniProt:

⊟Protein sequence

• MIEINNLSKRYRNKQIFNHLTMSFDSNRLTVLLGDNGAGKSTLLRMIAGIEKANDGTINYFGEKWNQRQIQNHIGYVPQDIALFEHMTVAENIKFFKSLCKNPINDTTINEYLQQLNFDDTSAKVSTLSGGNKRKINILVGLLGQPRILILDEPTVGIDLKSRHDIHQLLNIMKSKCLIILTTHHLDEVEALADDIKLIGQDPFYQHVLEDKQWTYTYY

⊟Experimental data

• experimentally validated: no data available

⊟Expression & Regulation

⊟Operon

• NWMN_RS01185 no polycistronic organisation predicted

⊟Regulation

• sigma factor:
• regulator:

⊟Transcription pattern

• S.aureus Expression Data Browser: no data available

⊟Protein synthesis (provided by Aureolib)

• Aureolib: no data available

⊟Protein stability

• half-life: no data available

⊟Other Information

You are kindly invited to share additional interesting facts.