From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS08430 [old locus tag: NWMN_1498 ]
  • pan locus tag?: SAUPAN004182000
  • symbol: NWMN_RS08430
  • pan gene symbol?: aroE
  • synonym:
  • product: shikimate dehydrogenase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_RS08430 [old locus tag: NWMN_1498 ]
  • symbol: NWMN_RS08430
  • product: shikimate dehydrogenase
  • replicon: chromosome
  • strand: -
  • coordinates: 1664230..1665036
  • length: 807
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_009641 (1664230..1665036) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGAAATTTGCAGTTATAGGAAATCCTATTTCACATTCCTTGTCGCCCGTTATGCATAGA
    GCAAATTTTAATTCTTTGGGATTAGATGATACTTATGAAGCTTTAAATATTCCAATTGAA
    GATTTTCATTTAATTAAAGAAATTATTTCGAAAAAAGAATTAGAAGGCTTTAATATCACA
    ATTCCTCATAAAGAACGTATCATACCGTATTTAGATTATGTTGATGAACAAGCGATTAAT
    GCAGGTGCAGTTAACACTGTTTTGATAAAAGATGGCAAGTGGATAGGGTATAATACAGAT
    GGTATTGGTTATGTTAAAGGATTGCACAGCGTTTATCCAGATTTAGAAAATGCATACATT
    TTAATTTTGGGCGCAGGTGGTGCAAGTAAAGGTATTGCTTATGAATTAGCAAAATTTGTA
    AAGCCCAAATTAACTGTTGCGAATAGAACGATGGCTCGTTTTGAATCTTGGAATTTAAAT
    ATAAACCAAATTTCATTAGCAGATGCTGAAAAGTATTTAGCTGAATTCGATATCGTTATT
    AATACAACACCAGCGGGTATGGCTGGAAATAACGAAAGTATTATTAATTTAAAGCATCTT
    TCTCCCAATACTTTAATGAGTGATATTGTTTATATACCGTATAAAACACCTATTTTAGAG
    GAAGCAGAGCGCAAGGGAAACCATATTTATAATGGCTTAGATATGTTTGTTTACCAGGGT
    GCGGAAAGCTTTAAAATTTGGACTAATAAAGATGCTGATATTAATTCTATGAAAACAGCA
    GTTTTACAACAATTAAAAGGAGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    807

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_RS08430 [old locus tag: NWMN_1498 ]
  • symbol: NWMN_RS08430
  • description: shikimate dehydrogenase
  • length: 268
  • theoretical pI: 5.61475
  • theoretical MW: 29879
  • GRAVY: -0.130224

Function[edit source | edit]

  • reaction:
    EC 1.1.1.25?  ExPASy
    Shikimate dehydrogenaseShikimate + NADP+ = 3-dehydroshikimate + NADPH
  • TIGRFAM:
    MetabolismAmino acid biosynthesisAromatic amino acid familyshikimate dehydrogenase (TIGR00507; EC 1.1.1.25; HMM-score: 260.4)
    MetabolismAmino acid biosynthesisAromatic amino acid familyshikimate-5-dehydrogenase (TIGR01809; EC 1.1.1.25; HMM-score: 126.4)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminglutamyl-tRNA reductase (TIGR01035; EC 1.2.1.70; HMM-score: 32.8)
    Cellular processesCellular processesSporulation and germinationdipicolinic acid synthetase, A subunit (TIGR02853; HMM-score: 20.5)
  • TheSEED:
  • PFAM:
    AA_dh_N (CL0603) Shikimate_dh_N; Shikimate dehydrogenase substrate binding domain (PF08501; HMM-score: 103.4)
    NADP_Rossmann (CL0063) Shikimate_DH; Shikimate / quinate 5-dehydrogenase (PF01488; HMM-score: 39.3)
    Sacchrp_dh_NADP; Saccharopine dehydrogenase NADP binding domain (PF03435; HMM-score: 20.5)
    ApbA; Ketopantoate reductase PanE/ApbA (PF02558; HMM-score: 15)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    NWMN_RS0202030S ribosomal protein S6  [1] (data from MRSA252)
    NWMN_RS06645translation initiation factor IF-2  [1] (data from MRSA252)
    NWMN_RS08795trigger factor  [1] (data from MRSA252)
    NWMN_RS1229050S ribosomal protein L17  [1] (data from MRSA252)
    NWMN_RS14370malate:quinone oxidoreductase  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.241
    • Ymax_pos: 22
    • Cmax: 0.197
    • Cmax_pos: 22
    • Smax: 0.375
    • Smax_pos: 10
    • Smean: 0.277
    • D: 0.255
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446589415 NCBI
  • RefSeq: WP_000666761 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKFAVIGNPISHSLSPVMHRANFNSLGLDDTYEALNIPIEDFHLIKEIISKKELEGFNITIPHKERIIPYLDYVDEQAINAGAVNTVLIKDGKWIGYNTDGIGYVKGLHSVYPDLENAYILILGAGGASKGIAYELAKFVKPKLTVANRTMARFESWNLNINQISLADAEKYLAEFDIVINTTPAGMAGNNESIINLKHLSPNTLMSDIVYIPYKTPILEEAERKGNHIYNGLDMFVYQGAESFKIWTNKDADINSMKTAVLQQLKGE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_RS08430 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.0 1.1 1.2 1.3 1.4 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]