From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0419 [new locus tag: SA_RS02390 ]
  • pan locus tag?: SAUPAN002175000
  • symbol: metB
  • pan gene symbol?: mccB
  • synonym:
  • product: cystathionine gamma-synthase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0419 [new locus tag: SA_RS02390 ]
  • symbol: metB
  • product: cystathionine gamma-synthase
  • replicon: chromosome
  • strand: +
  • coordinates: 480605..481747
  • length: 1143
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    ATGAATAAGAAAACTAAATTAATTCACGGTGGACACACAACGGACGACTATACAGGTGCA
    GTTACTACACCAATTTATCAAACAAGTACATATTTACAAGATGATATTGGTGATTTACGT
    CAAGGATATGAATATTCTCGTACTGCGAATCCAACAAGAAGTTCTGTAGAAAGCGTTATT
    GCGGCATTAGAAAATGGCAAACATGGCTTTGCGTTTAGTTCAGGTGTTGCAGCTATCAGT
    GCAGTTGTTATGCTGTTGGACAAAGGTGATCATATTATTTTAAATTCAGATGTATACGGC
    GGTACTTATCGCGCATTGACAAAAGTATTTACACGATTTGGCATTGAAGTGGATTTTGTA
    GATACAACGCATACAGATTCAATTGTACAAGCGATACGCCCAACAACAAAGATGTTGTTT
    ATTGAAACACCTTCTAATCCATTATTACGTGTTACTGACATTAAAAAGTCTGCTGAAATT
    GCGAAAGAACACGGTTTGATTTCAGTCGTTGATAACACATTTATGACACCTTATTATCAG
    AATCCATTAGATTTAGGCATCGATATTGTCTTGCATTCTGCAACGAAATATTTAGGTGGA
    CATAGTGATGTCGTTGCTGGTTTAGTTGCAACATCGGATGACAAGCTTGCAGAACGTTTA
    GCATTTATTTCAAATTCAACAGGTGGCATTTTAGGACCTCAAGATAGCTATTTACTTGTG
    AGGGGTATTAAAACATTAGGTTTACGTATGGAACAAATTAATCGCAGTGTTATTGAAATT
    ATTAAAATGTTACAAGCACATCCAGCTGTGCAACAAGTGTTCCATCCAAGTATTGAAAGT
    CATTTAAATCATGATGTCCATATGGCTCAAGCGGATGGCCATACAGGTGTGATTGCATTT
    GAAGTGAAAAATACAGAAAGTGCCAAACAATTGATTAAAGCAACATCGTATTACACATTA
    GCTGAAAGTTTAGGTGCAGTGGAAAGTTTAATTTCAGTACCTGCATTGATGACACATGCA
    TCCATTCCAGCAGATATTCGAGCTAAAGAAGGTATTACAGACGGACTTGTAAGAATTTCT
    GTAGGTATTGAAGATACTGAAGATTTAGTCGATGATTTAAAACAAGCACTAGATACGCTA
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1143

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0419 [new locus tag: SA_RS02390 ]
  • symbol: MetB
  • description: cystathionine gamma-synthase
  • length: 380
  • theoretical pI: 5.67217
  • theoretical MW: 41248.5
  • GRAVY: -0.0371053

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    cystathionine beta-lyase (TIGR01329; EC 4.4.1.8; HMM-score: 398.1)
    MetabolismAmino acid biosynthesisAspartate familyO-succinylhomoserine (thiol)-lyase (TIGR02080; EC 2.5.1.48; HMM-score: 392.1)
    MetabolismEnergy metabolismAmino acids and aminesmethionine gamma-lyase (TIGR01328; EC 4.4.1.11; HMM-score: 379.3)
    MetabolismAmino acid biosynthesisAspartate familyO-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase (TIGR01326; HMM-score: 315.5)
    MetabolismAmino acid biosynthesisSerine familyO-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase (TIGR01326; HMM-score: 315.5)
    MetabolismAmino acid biosynthesisAspartate familyO-succinylhomoserine sulfhydrylase (TIGR01325; EC 4.2.99.-; HMM-score: 313.9)
    MetabolismAmino acid biosynthesisAspartate familycystathionine beta-lyase (TIGR01324; EC 4.4.1.8; HMM-score: 239.5)
    Unknown functionEnzymes of unknown specificitycysteine desulfurase family protein (TIGR01977; HMM-score: 32.1)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminthreonine-phosphate decarboxylase (TIGR01140; EC 4.1.1.81; HMM-score: 22.9)
    Unknown functionEnzymes of unknown specificitycysteine desulfurase family protein (TIGR01976; HMM-score: 21.6)
    MetabolismAmino acid biosynthesisHistidine familyhistidinol-phosphate transaminase (TIGR01141; EC 2.6.1.9; HMM-score: 21.2)
    UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine transaminase (TIGR03588; EC 2.6.1.92; HMM-score: 17.4)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOthercysteine desulfurase, SufS family (TIGR01979; HMM-score: 17.2)
    LL-diaminopimelate aminotransferase (TIGR03540; EC 2.6.1.83; HMM-score: 16.7)
    succinyldiaminopimelate transaminase (TIGR03537; EC 2.6.1.17; HMM-score: 13.8)
    succinyldiaminopimelate transaminase (TIGR03539; EC 2.6.1.17; HMM-score: 13.3)
    enduracididine biosynthesis enzyme MppP (TIGR04462; EC 2.-.-.-; HMM-score: 13.3)
    putative C-S lyase (TIGR04350; EC 4.4.-.-; HMM-score: 13)
    pullulanase, type I (TIGR02104; EC 3.2.1.41; HMM-score: 11)
  • TheSEED:  
    Amino Acids and DerivativesAlanine, serine, and glycineGlycine and Serine Utilization Cystathionine gamma-lyase (EC 4.4.1.1) 
    Lysine, threonine, methionine, and cysteineCysteine Biosynthesis Cystathionine gamma-lyase (EC 4.4.1.1) 
    Lysine, threonine, methionine, and cysteineMethionine Biosynthesis Cystathionine gamma-lyase (EC 4.4.1.1) 
    Lysine, threonine, methionine, and cysteineMethionine Degradation Cystathionine gamma-lyase (EC 4.4.1.1) 
  • PFAM:
    PLP_aminotran (CL0061) Cys_Met_Meta_PP; Cys/Met metabolism PLP-dependent enzyme (PF01053; HMM-score: 488.6)
    Aminotran_5; Aminotransferase class-V (PF00266; HMM-score: 35)
    Aminotran_1_2; Aminotransferase class I and II (PF00155; HMM-score: 28)
    DegT_DnrJ_EryC1; DegT/DnrJ/EryC1/StrS aminotransferase family (PF01041; HMM-score: 21)
    no clan definedIF-2; Translation-initiation factor 2 (PF11987; HMM-score: 15.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.119
    • Ymax_pos: 11
    • Cmax: 0.107
    • Cmax_pos: 35
    • Smax: 0.163
    • Smax_pos: 1
    • Smean: 0.137
    • D: 0.126
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 15926138 NCBI
  • RefSeq: NP_373671 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MNKKTKLIHGGHTTDDYTGAVTTPIYQTSTYLQDDIGDLRQGYEYSRTANPTRSSVESVIAALENGKHGFAFSSGVAAISAVVMLLDKGDHIILNSDVYGGTYRALTKVFTRFGIEVDFVDTTHTDSIVQAIRPTTKMLFIETPSNPLLRVTDIKKSAEIAKEHGLISVVDNTFMTPYYQNPLDLGIDIVLHSATKYLGGHSDVVAGLVATSDDKLAERLAFISNSTGGILGPQDSYLLVRGIKTLGLRMEQINRSVIEIIKMLQAHPAVQQVFHPSIESHLNHDVHMAQADGHTGVIAFEVKNTESAKQLIKATSYYTLAESLGAVESLISVPALMTHASIPADIRAKEGITDGLVRISVGIEDTEDLVDDLKQALDTL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: SA1453 (CymR*)
    CymR* (TF) important in Cysteine metabolismRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]