From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1172 [new locus tag: SA_RS06660 ]
  • pan locus tag?: SAUPAN003710000
  • symbol: SA1172
  • pan gene symbol?: guaC
  • synonym:
  • product: guanosine 5'-monophosphate oxidoreductase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1172 [new locus tag: SA_RS06660 ]
  • symbol: SA1172
  • product: guanosine 5'-monophosphate oxidoreductase
  • replicon: chromosome
  • strand: +
  • coordinates: 1334736..1335713
  • length: 978
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    GTGAAAATATTTGATTACGAAGATATTCAATTAATACCTAATAAATGCATAGTTGAAAGT
    AGGTCTGAATGTGATACAACTATCCAATTTGGTCCGAAAAAATTCAAGCTACCTGTAGTT
    CCTGCAAATATGCAAACAGTTATGAATGAGAAATTAGCGAAATGGTTTGCTGAAAATGAT
    TACTTTTATATCATGCATCGTTTTGATGAAGAAGCAAGAATACCTTTTATAAAACATATG
    CAAAATTCAGGCTTATTTGCATCTATTTCAGTTGGTGTAAAGAAAGCGGAATTTGATTTT
    ATTGAAAAGTTAGCTCAAGAAAAATTAATCCCCGAATATATTACAATAGATATTGCGCAT
    GGTCACTCAGATTCAGTGATAAACATGATTAAACATATAAAAAACCATATACCTGATAGT
    TTTGTTATTGCTGGTAATGTTGGTACGCCAGAAGGTGTTAGAGAATTAGAAAATGCTGGT
    GCTGATGCTACCAAAGTCGGTATAGGTCCTGGTAGAGTTTGTATTACAAAGATTAAAACA
    GGTTTTGGTACTGGTGGTTGGCAGTTAGCGGCATTAAACATATGTAGTAAAGCAGCTCGT
    AAACCTTTGATTGCCGATGGTGGTATAAGAACGCATGGCGACATCGCTAAATCAATTAGA
    TTTGGTGCATCAATGGTCATGATTGGTTCATTATTTGCGGCACACGAAGAATCACCTGGT
    GAAACTGTAGAACTTGATGGTAAACAGTATAAAGAATATTTTGGTAGTGCATCTGAATTT
    CAAAAAGGCGAACATAAAAATGTAGAAGGTAAAAAAATGTTTGTAGAACATAAGGGTTCA
    TTAATGGATACCTTAAAAGAAATGCAACAAGATTTACAAAGCTCAATTTCATATGCCGGT
    GGAAAAGACTTGAAATCATTACGTACTGTAGATTATGTTATTGTTAGAAACTCTATTTTC
    AACGGTGATAGAGATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    978

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1172 [new locus tag: SA_RS06660 ]
  • symbol: SA1172
  • description: guanosine 5'-monophosphate oxidoreductase
  • length: 325
  • theoretical pI: 7.06414
  • theoretical MW: 36129.2
  • GRAVY: -0.288308

Function[edit source | edit]

  • reaction:
    EC 1.7.1.7?  ExPASy
    GMP reductaseInosine 5'-phosphate + NH3 + NADP+ = guanosine 5'-phosphate + NADPH
  • TIGRFAM:
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesNucleotide and nucleoside interconversionsguanosine monophosphate reductase (TIGR01306; EC 1.7.1.7; HMM-score: 699.8)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisinosine-5'-monophosphate dehydrogenase (TIGR01302; EC 1.1.1.205; HMM-score: 186.4)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesNucleotide and nucleoside interconversionsguanosine monophosphate reductase (TIGR01305; EC 1.7.1.7; HMM-score: 175.8)
    Unknown functionGeneralIMP dehydrogenase family protein (TIGR01303; HMM-score: 139.8)
    Unknown functionGeneralIMP dehydrogenase family protein (TIGR01304; HMM-score: 58.5)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtherisopentenyl-diphosphate delta-isomerase, type 2 (TIGR02151; EC 5.3.3.2; HMM-score: 31.7)
    glycosyl amidation-associated protein WbuZ (TIGR03572; HMM-score: 25.5)
    MetabolismAmino acid biosynthesisHistidine family1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase (TIGR00007; EC 5.3.1.16; HMM-score: 21.1)
    MetabolismAmino acid biosynthesisHistidine familyimidazoleglycerol phosphate synthase, cyclase subunit (TIGR00735; HMM-score: 18.4)
    geranylgeranylglyceryl phosphate synthase family protein (TIGR01768; EC 2.5.1.-; HMM-score: 16.5)
    heme/flavin dehydrogenase, mycofactocin system (TIGR03966; EC 1.-.-.-; HMM-score: 14.3)
    MetabolismAmino acid biosynthesisGlutamate family2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase (TIGR01182; EC 4.1.2.14,4.1.3.16; HMM-score: 14.1)
    MetabolismEnergy metabolismEntner-Doudoroff2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase (TIGR01182; EC 4.1.2.14,4.1.3.16; HMM-score: 14.1)
    putative enoyl-[acyl-carrier-protein] reductase II (TIGR03151; EC 1.3.1.-; HMM-score: 13.9)
  • TheSEED:  
    Nucleosides and NucleotidesPurinesPurine conversions GMP reductase (EC 1.7.1.7) 
  • PFAM:
    TIM_barrel (CL0036) IMPDH; IMP dehydrogenase / GMP reductase domain (PF00478; HMM-score: 228.2)
    His_biosynth; Histidine biosynthesis protein (PF00977; HMM-score: 27.2)
    FMN_dh; FMN-dependent dehydrogenase (PF01070; HMM-score: 26.6)
    NMO; Nitronate monooxygenase (PF03060; HMM-score: 26.2)
    ThiG; Thiazole biosynthesis protein ThiG (PF05690; HMM-score: 17.5)
    DHO_dh; Dihydroorotate dehydrogenase (PF01180; HMM-score: 17.2)
    TMP-TENI; Thiamine monophosphate synthase (PF02581; HMM-score: 15.9)
    Glu_synthase; Conserved region in glutamate synthase (PF01645; HMM-score: 13.5)
    Aldolase; KDPG and KHG aldolase (PF01081; HMM-score: 13.2)
    G3P_antiterm; Glycerol-3-phosphate responsive antiterminator (PF04309; HMM-score: 12.7)
    IGPS; Indole-3-glycerol phosphate synthase (PF00218; HMM-score: 11.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    SA1517(citC)isocitrate dehydrogenase  [1] (data from MRSA252)
    SA0865(ppnK)inorganic polyphosphate/ATP-NAD kinase  [1] (data from MRSA252)
    SA1402hypothetical protein  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.115
    • Ymax_pos: 57
    • Cmax: 0.107
    • Cmax_pos: 57
    • Smax: 0.183
    • Smax_pos: 51
    • Smean: 0.106
    • D: 0.112
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKIFDYEDIQLIPNKCIVESRSECDTTIQFGPKKFKLPVVPANMQTVMNEKLAKWFAENDYFYIMHRFDEEARIPFIKHMQNSGLFASISVGVKKAEFDFIEKLAQEKLIPEYITIDIAHGHSDSVINMIKHIKNHIPDSFVIAGNVGTPEGVRELENAGADATKVGIGPGRVCITKIKTGFGTGGWQLAALNICSKAARKPLIADGGIRTHGDIAKSIRFGASMVMIGSLFAAHEESPGETVELDGKQYKEYFGSASEFQKGEHKNVEGKKMFVEHKGSLMDTLKEMQQDLQSSISYAGGKDLKSLRTVDYVIVRNSIFNGDRD

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.0 1.1 1.2 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]