Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS02950 [old locus tag: SACOL0568 ]
  • pan locus tag?: SAUPAN002288000
  • symbol: SACOL_RS02950
  • pan gene symbol?: mcsA
  • synonym:
  • product: excinuclease ABC subunit B

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS02950 [old locus tag: SACOL0568 ]
  • symbol: SACOL_RS02950
  • product: excinuclease ABC subunit B
  • replicon: chromosome
  • strand: +
  • coordinates: 588554..589042
  • length: 489
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (588554..589042) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGGTGTGTCAAACTTGTGCTGAGGGACACCATCCGTGGAATCAAGCTAATGAACAACCT
    GAATATCAAGAACATCAAGATAATTTCGAAGAAGCATTTGTTGTTAAGCAAATTTTACAA
    CATTTAGCTACGAAACATGGAATTAATTTTCAAGAAGTAGCGTTTAAAGAAGAAAAACGT
    TGCCCATCATGTCATATGACTTTGAAAGATATTGCACATGTTGGTAAATTTGGGTGTGCT
    AATTGTTATGCAACATTTAAAGATGACATCATTGATATCGTCCGCAGAGTTCAAGGTGGA
    CAATTTGAGCACGTTGGAAAGACACCACATTCTTCACATAAAAAGATAGCTTTAAAGCGA
    AAAATCGAAGAAAAGAATGAATATTTGAAAAAACTTATTGAAATCCAAGATTTTGAGGAA
    GCAGCCATTGTTAGAGATGAAATTAAAGCACTAAAAGCTGAGAGTGAGGTGCAACATGAT
    GACGCATAA
    60
    120
    180
    240
    300
    360
    420
    480
    489

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS02950 [old locus tag: SACOL0568 ]
  • symbol: SACOL_RS02950
  • description: excinuclease ABC subunit B
  • length: 162
  • theoretical pI: 6.42997
  • theoretical MW: 18710
  • GRAVY: -0.72037

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingDNA metabolismDNA replication, recombination, and repairexcinuclease ABC subunit B (TIGR00631; EC 3.1.25.-; HMM-score: 14.8)
    MetabolismTransport and binding proteinsCations and iron carrying compoundssodium/hydrogen antiporter (TIGR00844; HMM-score: 12)
  • TheSEED:
  • PFAM:
    no clan definedUVR; UvrB/uvrC motif (PF02151; HMM-score: 23)
    Zn_Beta_Ribbon (CL0167) OrfB_Zn_ribbon; Putative transposase DNA-binding domain (PF07282; HMM-score: 16.5)
    Zn_Tnp_IS1595; Transposase zinc-ribbon domain (PF12760; HMM-score: 16.5)
    Zn-ribbon_8; Zinc ribbon domain (PF09723; HMM-score: 11.5)
    Multiheme_cytos (CL0317) Cytochrom_CIII; Class III cytochrome C family (PF02085; HMM-score: 9.6)
    Zn_Beta_Ribbon (CL0167) zinc-ribbons_6; zinc-ribbons (PF07191; HMM-score: 8.1)
    RING (CL0229) Prok-RING_1; Prokaryotic RING finger family 1 (PF14446; HMM-score: 6.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.141
    • Ymax_pos: 57
    • Cmax: 0.18
    • Cmax_pos: 57
    • Smax: 0.195
    • Smax_pos: 16
    • Smean: 0.1
    • D: 0.125
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI:
  • RefSeq: WP_011443618 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MVCQTCAEGHHPWNQANEQPEYQEHQDNFEEAFVVKQILQHLATKHGINFQEVAFKEEKRCPSCHMTLKDIAHVGKFGCANCYATFKDDIIDIVRRVQGGQFEHVGKTPHSSHKKIALKRKIEEKNEYLKKLIEIQDFEEAAIVRDEIKALKAESEVQHDDA

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS02950 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]