From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0568 [new locus tag: SACOL_RS02950 ]
  • pan locus tag?: SAUPAN002288000
  • symbol: SACOL0568
  • pan gene symbol?: mcsA
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL0568 [new locus tag: SACOL_RS02950 ]
  • symbol: SACOL0568
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 588476..589042
  • length: 567
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    GTGCTTTGTGAAAATTGTCAACTTAATGAAGCGGAATTAAAAGTTAAAGTTACAAGTAAA
    AATAAAACAGAAGAAAAAATGGTGTGTCAAACTTGTGCTGAGGGACACCATCCGTGGAAT
    CAAGCTAATGAACAACCTGAATATCAAGAACATCAAGATAATTTCGAAGAAGCATTTGTT
    GTTAAGCAAATTTTACAACATTTAGCTACGAAACATGGAATTAATTTTCAAGAAGTAGCG
    TTTAAAGAAGAAAAACGTTGCCCATCATGTCATATGACTTTGAAAGATATTGCACATGTT
    GGTAAATTTGGGTGTGCTAATTGTTATGCAACATTTAAAGATGACATCATTGATATCGTC
    CGCAGAGTTCAAGGTGGACAATTTGAGCACGTTGGAAAGACACCACATTCTTCACATAAA
    AAGATAGCTTTAAAGCGAAAAATCGAAGAAAAGAATGAATATTTGAAAAAACTTATTGAA
    ATCCAAGATTTTGAGGAAGCAGCCATTGTTAGAGATGAAATTAAAGCACTAAAAGCTGAG
    AGTGAGGTGCAACATGATGACGCATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    567

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL0568 [new locus tag: SACOL_RS02950 ]
  • symbol: SACOL0568
  • description: hypothetical protein
  • length: 188
  • theoretical pI: 6.43087
  • theoretical MW: 21702.5
  • GRAVY: -0.752128

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingDNA metabolismDNA replication, recombination, and repairexcinuclease ABC subunit B (TIGR00631; EC 3.1.25.-; HMM-score: 12.9)
    MetabolismTransport and binding proteinsCations and iron carrying compoundssodium/hydrogen antiporter (TIGR00844; HMM-score: 11.5)
  • TheSEED:  
    Protein MetabolismProtein degradationProteolysis in bacteria, ATP-dependent Nucleotide excision repair protein, with UvrB/UvrC motif 
  • PFAM:
    no clan definedUVR; UvrB/uvrC motif (PF02151; HMM-score: 22.7)
    Zn_Beta_Ribbon (CL0167) OrfB_Zn_ribbon; Putative transposase DNA-binding domain (PF07282; HMM-score: 18.4)
    Zn_Tnp_IS1595; Transposase zinc-ribbon domain (PF12760; HMM-score: 16.1)
    no clan definedPHF5; PHF5-like protein (PF03660; HMM-score: 13.1)
    Zn_Beta_Ribbon (CL0167) Elf1; Transcription elongation factor Elf1 like (PF05129; HMM-score: 10.5)
    zf-FPG_IleRS; Zinc finger found in FPG and IleRS (PF06827; HMM-score: 9.8)
    Zn-ribbon_8; Zinc ribbon domain (PF09723; HMM-score: 8.6)
    Multiheme_cytos (CL0317) Cytochrom_CIII; Class III cytochrome C family (PF02085; HMM-score: 8.1)
    Zn_Beta_Ribbon (CL0167) zinc-ribbons_6; zinc-ribbons (PF07191; HMM-score: 7.9)
    zf-FYVE-PHD (CL0390) FYVE; FYVE zinc finger (PF01363; HMM-score: 6.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.191
    • Ymax_pos: 22
    • Cmax: 0.143
    • Cmax_pos: 22
    • Smax: 0.362
    • Smax_pos: 6
    • Smean: 0.268
    • D: 0.221
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MLCENCQLNEAELKVKVTSKNKTEEKMVCQTCAEGHHPWNQANEQPEYQEHQDNFEEAFVVKQILQHLATKHGINFQEVAFKEEKRCPSCHMTLKDIAHVGKFGCANCYATFKDDIIDIVRRVQGGQFEHVGKTPHSSHKKIALKRKIEEKNEYLKKLIEIQDFEEAAIVRDEIKALKAESEVQHDDA

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]