From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS05280 [old locus tag: SACOL1035 ]
  • pan locus tag?: SAUPAN003214000
  • symbol: SACOL_RS05280
  • pan gene symbol?:
  • synonym:
  • product: DUF2187 domain-containing protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS05280 [old locus tag: SACOL1035 ]
  • symbol: SACOL_RS05280
  • product: DUF2187 domain-containing protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1044803..1044979
  • length: 177
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1044803..1044979) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    ATGACTGTTGCAGAAGTGGGTAACATTGTTGAGTTTATGGATGGATTAAGAGGTCGTGTT
    GAAAAAATCAACGATAACTCTGTTATTGTTGACTTAACAATTATGGAAAATTTTAATGAC
    CTTGATTTACCGGAAAAAACTGTTATCAATCATAAACGATATAAGATTGTTGAATAA
    60
    120
    177

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS05280 [old locus tag: SACOL1035 ]
  • symbol: SACOL_RS05280
  • description: DUF2187 domain-containing protein
  • length: 58
  • theoretical pI: 4.46294
  • theoretical MW: 6676.64
  • GRAVY: -0.17069

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein fateProtein and peptide secretion and traffickingpreprotein translocase, YajC subunit (TIGR00739; HMM-score: 13.6)
  • TheSEED:
  • PFAM:
    no clan definedDUF2187; Uncharacterized protein conserved in bacteria (DUF2187) (PF09953; HMM-score: 97.6)
    NTP_transf (CL0260) DUF2204; Nucleotidyl transferase of unknown function (DUF2204) (PF09970; HMM-score: 14.9)
    no clan definedYajC; Preprotein translocase subunit (PF02699; HMM-score: 13)
    Miga; Mitoguardin (PF10265; HMM-score: 11.2)

Structure, modifications & interactions[edit source | edit]

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.099
    • Ymax_pos: 52
    • Cmax: 0.106
    • Cmax_pos: 23
    • Smax: 0.108
    • Smax_pos: 50
    • Smean: 0.077
    • D: 0.09
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446137043 NCBI
  • RefSeq: WP_000214898 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MTVAEVGNIVEFMDGLRGRVEKINDNSVIVDLTIMENFNDLDLPEKTVINHKRYKIVE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS05280 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.0 1.1 1.2 1.3 1.4 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]