From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS08250 [old locus tag: SACOL1618 ]
  • pan locus tag?: SAUPAN004142000
  • symbol: SACOL_RS08250
  • pan gene symbol?: sigA
  • synonym:
  • product: RNA polymerase sigma factor SigA

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS08250 [old locus tag: SACOL1618 ]
  • symbol: SACOL_RS08250
  • product: RNA polymerase sigma factor SigA
  • replicon: chromosome
  • strand: -
  • coordinates: 1648459..1649565
  • length: 1107
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1648459..1649565) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    ATGTCTGATAACACAGTTAAAATTAAAAAACAAACAATTGATCCGACATTAACATTAGAA
    GATGTTAAGAAGCAATTAATTGAAAAAGGTAAAAAAGAGGGTCATTTAAGTCATGAAGAA
    ATTGCTGAAAAACTTCAGAATTTTGATATCGACTCTGATCAAATGGATGATTTCTTTGAT
    CAATTAAATGATAATGATATTTCACTAGTTAATGAAAAAGATAGTTCAGATACTGACGAG
    AAACTGAATCCAAGTGATCTTAGTGCCCCTCCAGGTGTTAAAATAAATGACCCAGTTCGT
    ATGTACCTTAAAGAAATTGGGCGTGTTAACTTATTAAGTGCACAAGAAGAAATCGAATTA
    GCCAAACGTATTGAACAAGGTGATGAAGTAGCAAAATCAAGACTTGCAGAAGCGAACTTA
    CGTTTAGTTGTAAGTATTGCTAAAAGATACGTAGGTCGTGGTATGTTATTCCTTGATTTA
    ATCCAAGAAGGTAATATGGGTCTTATTAAAGCTGTTGAAAAATTTGACTTTAACAAAGGA
    TTTAAGTTTTCAACATATGCAACATGGTGGATTAGACAAGCAATCACTCGTGCAATTGCT
    GACCAAGCACGTACGATTCGTATCCCTGTGCATATGGTAGAAACAATTAATAAATTAATT
    CGTGTTCAACGTCAATTATTACAGGACTTAGGTCGAGATCCAGCACCAGAAGAAATTGGT
    GAAGAAATGGATTTACCAGCAGAAAAAGTTCGTGAAATTTTAAAAATTGCGCAAGAACCT
    GTTTCATTAGAAACACCAATTGGTGAAGAAGATGATAGTCATTTAGGAGACTTTATTGAG
    GATCAGGAAGCACAAAGTCCTTCAGATCATGCTGCTTATGAATTATTAAAAGAGCAATTA
    GAAGATGTGCTTGATACATTAACTGATAGAGAAGAAAATGTATTACGATTAAGATTTGGT
    CTTGATGACGGCAGAACAAGAACACTTGAAGAAGTTGGTAAAGTTTTCGGTGTTACACGT
    GAACGTATTCGACAAATTGAAGCAAAAGCACTTAGAAAATTAAGACATCCAAGTCGTAGT
    AAACGTTTGAAAGACTTTATGGATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1107

Protein[edit source | edit]

Protein Data Bank: 4G6D
Protein Data Bank: 4G8X
Protein Data Bank: 4G94

General[edit source | edit]

  • locus tag: SACOL_RS08250 [old locus tag: SACOL1618 ]
  • symbol: SACOL_RS08250
  • description: RNA polymerase sigma factor SigA
  • length: 368
  • theoretical pI: 4.72503
  • theoretical MW: 42170.5
  • GRAVY: -0.629891

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingTranscriptionTranscription factorsRNA polymerase sigma factor RpoD (TIGR02393; HMM-score: 410.6)
    RNA polymerase sigma factor, cyanobacterial RpoD-like family (TIGR02997; HMM-score: 354)
    Cellular processesCellular processesAdaptations to atypical conditionsRNA polymerase sigma factor RpoS (TIGR02394; HMM-score: 323.7)
    Genetic information processingTranscriptionTranscription factorsRNA polymerase sigma factor RpoS (TIGR02394; HMM-score: 323.7)
    Cellular processesCellular processesAdaptations to atypical conditionsalternative sigma factor RpoH (TIGR02392; HMM-score: 162.9)
    Genetic information processingTranscriptionTranscription factorsalternative sigma factor RpoH (TIGR02392; HMM-score: 162.9)
    RNA polymerase sigma-70 factor, sigma-B/F/G subfamily (TIGR02980; HMM-score: 131.8)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 131.6)
    Cellular processesCellular processesSporulation and germinationRNA polymerase sigma-G factor (TIGR02850; HMM-score: 127)
    Genetic information processingTranscriptionTranscription factorsRNA polymerase sigma-G factor (TIGR02850; HMM-score: 127)
    RNA polymerase sigma factor, FliA/WhiG family (TIGR02479; HMM-score: 121.2)
    Cellular processesCellular processesSporulation and germinationRNA polymerase sigma-F factor (TIGR02885; HMM-score: 120.8)
    Genetic information processingTranscriptionTranscription factorsRNA polymerase sigma-F factor (TIGR02885; HMM-score: 120.8)
    Cellular processesCellular processesSporulation and germinationRNA polymerase sigma-K factor (TIGR02846; HMM-score: 114.8)
    Genetic information processingTranscriptionTranscription factorsRNA polymerase sigma-K factor (TIGR02846; HMM-score: 114.8)
    Cellular processesCellular processesSporulation and germinationRNA polymerase sigma-E factor (TIGR02835; HMM-score: 103.7)
    Genetic information processingTranscriptionTranscription factorsRNA polymerase sigma-E factor (TIGR02835; HMM-score: 103.7)
    RNA polymerase sigma-B factor (TIGR02941; HMM-score: 75.2)
    Cellular processesCellular processesSporulation and germinationRNA polymerase sigma-H factor (TIGR02859; HMM-score: 40.4)
    Genetic information processingTranscriptionTranscription factorsRNA polymerase sigma-H factor (TIGR02859; HMM-score: 40.4)
    RNA polymerase sigma-70 factor, TIGR02952 family (TIGR02952; HMM-score: 31.2)
    RNA polymerase sigma-70 factor, Planctomycetaceae-specific subfamily 1 (TIGR02984; HMM-score: 19.6)
    Genetic information processingDNA metabolismDegradation of DNAexodeoxyribonuclease VII, large subunit (TIGR00237; EC 3.1.11.6; HMM-score: 13.8)
    RNA polymerase sigma factor RpoE (TIGR02939; HMM-score: 12.8)
    Cellular processesCellular processesSporulation and germinationRNA polymerase sigma-I factor (TIGR02895; HMM-score: 12.5)
    Genetic information processingTranscriptionTranscription factorsRNA polymerase sigma-I factor (TIGR02895; HMM-score: 12.5)
    RNA polymerase sigma-70 factor, sigma-E family (TIGR02983; HMM-score: 12.5)
    Signal transductionRegulatory functionsDNA interactionsDNA-binding protein, Tfx family (TIGR00721; HMM-score: 12.4)
    RNA polymerase sigma-70 factor, TIGR02954 family (TIGR02954; HMM-score: 11.7)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersChlorophyll and bacteriochlorphylllight-independent protochlorophyllide reductase, N subunit (TIGR01279; EC 1.3.7.7; HMM-score: 11.2)
  • TheSEED:
  • PFAM:
    HTH (CL0123) Sigma70_r3; Sigma-70 region 3 (PF04539; HMM-score: 106.7)
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 83.7)
    Sigma70_r2; Sigma-70 region 2 (PF04542; HMM-score: 77.9)
    no clan definedSigma70_r1_2; Sigma-70 factor, region 1.2 (PF00140; HMM-score: 67.7)
    Sigma70_r1_1; Sigma-70 factor, region 1.1 (PF03979; HMM-score: 61.1)
    Exonuc_VII_L; Exonuclease VII, large subunit (PF02601; HMM-score: 16.5)
    HTH (CL0123) HTH_10; HTH DNA binding domain (PF04967; HMM-score: 13.3)
    no clan definedPolyA_pol_arg_C; Polymerase A arginine-rich C-terminus (PF12626; HMM-score: 12.5)
    DUF4107; Protein of unknown function (DUF4107) (PF13389; HMM-score: 10.9)

Structure, modifications & interactions[edit source | edit]

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.127
    • Ymax_pos: 31
    • Cmax: 0.105
    • Cmax_pos: 35
    • Smax: 0.209
    • Smax_pos: 24
    • Smean: 0.125
    • D: 0.126
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 447205799 NCBI
  • RefSeq: WP_001283055 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MSDNTVKIKKQTIDPTLTLEDVKKQLIEKGKKEGHLSHEEIAEKLQNFDIDSDQMDDFFDQLNDNDISLVNEKDSSDTDEKLNPSDLSAPPGVKINDPVRMYLKEIGRVNLLSAQEEIELAKRIEQGDEVAKSRLAEANLRLVVSIAKRYVGRGMLFLDLIQEGNMGLIKAVEKFDFNKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVETINKLIRVQRQLLQDLGRDPAPEEIGEEMDLPAEKVREILKIAQEPVSLETPIGEEDDSHLGDFIEDQEAQSPSDHAAYELLKEQLEDVLDTLTDREENVLRLRFGLDDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLRHPSRSKRLKDFMD

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS08250 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 1.9

Relevant publications[edit source | edit]