From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS07705 [old locus tag: SACOL1513 ]
  • pan locus tag?: SAUPAN003934000
  • symbol: SACOL_RS07705
  • pan gene symbol?: hup
  • synonym:
  • product: DNA-binding protein HU

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS07705 [old locus tag: SACOL1513 ]
  • symbol: SACOL_RS07705
  • product: DNA-binding protein HU
  • replicon: chromosome
  • strand: -
  • coordinates: 1552269..1552541
  • length: 273
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1552269..1552541) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    ATGAACAAAACAGATTTAATCAATGCAGTTGCAGAGCAAGCTGATTTAACTAAAAAAGAA
    GCTGGTTCAGCAGTAGATGCTGTATTCGAATCAATCCAAAACTCACTTGCTAAAGGTGAA
    AAAGTACAATTAATTGGTTTCGGTAACTTTGAGGTACGTGAACGTGCTGCACGTAAAGGT
    CGTAACCCTCAAACTGGTAAAGAAATTGATATCCCAGCAAGTAAAGTTCCAGCATTCAAA
    GCTGGTAAAGCATTAAAAGATGCTGTAAAATAA
    60
    120
    180
    240
    273

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS07705 [old locus tag: SACOL1513 ]
  • symbol: SACOL_RS07705
  • description: DNA-binding protein HU
  • length: 90
  • theoretical pI: 10.3214
  • theoretical MW: 9625.94
  • GRAVY: -0.466667

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingDNA metabolismDNA replication, recombination, and repairintegration host factor, beta subunit (TIGR00988; HMM-score: 85.5)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairintegration host factor, alpha subunit (TIGR00987; HMM-score: 80.7)
    Genetic information processingDNA metabolismChromosome-associated proteinsputative DNA-binding protein (TIGR01201; HMM-score: 22.4)
  • TheSEED:
  • PFAM:
    IHF-likeDNA-bdg (CL0548) Bac_DNA_binding; Bacterial DNA-binding protein (PF00216; HMM-score: 125.8)
    no clan definedDUF4496; Domain of unknown function (DUF4496) (PF14908; HMM-score: 17.2)
    DUF2267; Uncharacterized conserved protein (DUF2267) (PF10025; HMM-score: 16.2)

Structure, modifications & interactions[edit source | edit]

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.136
    • Ymax_pos: 38
    • Cmax: 0.186
    • Cmax_pos: 38
    • Smax: 0.202
    • Smax_pos: 37
    • Smean: 0.115
    • D: 0.128
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446966607 NCBI
  • RefSeq: WP_001043863 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MNKTDLINAVAEQADLTKKEAGSAVDAVFESIQNSLAKGEKVQLIGFGNFEVRERAARKGRNPQTGKEIDIPASKVPAFKAGKALKDAVK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS07705 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35

Relevant publications[edit source | edit]