From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS00470 [old locus tag: SACOL0095 ]
  • pan locus tag?: SAUPAN000909000
  • symbol: SACOL_RS00470
  • pan gene symbol?: spa
  • synonym:
  • product: peptidoglycan-binding protein LysM

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS00470 [old locus tag: SACOL0095 ]
  • symbol: SACOL_RS00470
  • product: peptidoglycan-binding protein LysM
  • replicon: chromosome
  • strand: -
  • coordinates: 107364..108890
  • length: 1527
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (107364..108890) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    1261
    1321
    1381
    1441
    1501
    TTGAAAAAGAAAAACATTTATTCAATTCGTAAACTAGGTGTAGGTATTGCATCTGTAACT
    TTAGGTACATTACTTATATCTGGTGGCGTAACACCTGCTGCAAATGCTGCGCAACACGAT
    GAAGCTCAACAAAATGCTTTTTATCAAGTCTTAAATATGCCTAACTTAAATGCTGATCAA
    CGCAATGGTTTTATCCAAAGCCTTAAAGATGATCCAAGCCAAAGTGCTAACGTTTTAGGT
    GAAGCTCAAAAACTTAATGACTCTCAAGCTCCAAAAGCTGATGCGCAACAAAATAACTTC
    AACAAAGATCAACAAAGCGCCTTCTATGAAATCTTGAACATGCCTAACTTAAACGAAGCG
    CAACGTAACGGCTTCATTCAAAGTCTTAAAGACGACCCAAGCCAAAGCACTAACGTTTTA
    GGTGAAGCTAAAAAATTAAACGAATCTCAAGCACCGAAAGCTGATAACAATTTCAACAAA
    GAACAACAAAATGCTTTCTATGAAATCTTGAATATGCCTAACTTAAACGAAGAACAACGC
    AATGGTTTCATCCAAAGCTTAAAAGATGACCCAAGCCAAAGTGCTAACCTATTGTCAGAA
    GCTAAAAAGTTAAATGAATCTCAAGCACCGAAAGCGGATAACAAATTCAACAAAGAACAA
    CAAAATGCTTTCTATGAAATCTTACATTTACCTAACTTAAACGAAGAACAACGCAATGGT
    TTCATCCAAAGCCTAAAAGATGACCCAAGCCAAAGCGCTAACCTTTTAGCAGAAGCTAAA
    AAGCTAAATGATGCTCAAGCACCAAAAGCTGACAACAAATTCAACAAAGAACAACAAAAT
    GCTTTCTATGAAATTTTACATTTACCTAACTTAACTGAAGAACAACGTAACGGCTTCATC
    CAAAGCCTTAAAGACGATCCTTCAGTGAGCAAAGAAATTTTAGCAGAAGCTAAAAAGCTA
    AACGATGCTCAAGCACCAAAAGAGGAAGACAATAACAAGCCTGGCAAAGAAGACAATAAC
    AAGCCTGGCAAAGAAGACAACAACAAGCCTGGTAAAGAAGACAACAACAAGCCTGGCAAA
    GAAGACGGCAACAAGCCTGGTAAAGAAGACAACAAAAAACCTGGTAAAGAAGATGGCAAC
    AAGCCTGGTAAAGAAGACAACAAAAAACCTGGTAAAGAAGACGGCAACAAGCCTGGCAAA
    GAAGATGGCAACAAACCTGGTAAAGAAGATGGTAACGGAGTACATGTCGTTAAACCTGGT
    GATACAGTAAATGACATTGCAAAAGCAAACGGCACTACTGCTGACAAAATTGCTGCAGAT
    AACAAATTAGCTGATAAAAACATGATCAAACCTGGTCAAGAACTTGTTGTTGATAAGAAG
    CAACCAGCAAACCATGCAGATGCTAACAAAGCTCAAGCATTACCAGAAACTGGTGAAGAA
    AATCCATTCATCGGTACAACTGTATTTGGTGGATTATCATTAGCCTTAGGTGCAGCGTTA
    TTAGCTGGACGTCGTCGCGAACTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1260
    1320
    1380
    1440
    1500
    1527

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS00470 [old locus tag: SACOL0095 ]
  • symbol: SACOL_RS00470
  • description: peptidoglycan-binding protein LysM
  • length: 508
  • theoretical pI: 5.36436
  • theoretical MW: 55553.8
  • GRAVY: -1.13445

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    gram-positive signal peptide, YSIRK family (TIGR01168; HMM-score: 34.6)
    Cell structureCell envelopeOtherLPXTG cell wall anchor domain (TIGR01167; HMM-score: 19.4)
    Cellular processesCellular processesSporulation and germinationspore coat assembly protein SafA (TIGR02899; HMM-score: 17.6)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersGlutathione and analogsbacillithiol biosynthesis deacetylase BshB2 (TIGR04000; EC 3.-.-.-; HMM-score: 8.9)
  • TheSEED:
  • PFAM:
    B_GA (CL0598) B; B domain (PF02216; HMM-score: 474.6)
    GA; GA module (PF01468; HMM-score: 53.2)
    LysM (CL0187) LysM; LysM domain (PF01476; HMM-score: 48.7)
    no clan definedYSIRK_signal; YSIRK type signal peptide (PF04650; HMM-score: 38.4)
    Gram_pos_anchor; LPXTG cell wall anchor motif (PF00746; HMM-score: 38.3)
    Octapeptide; Octapeptide repeat (PF03373; HMM-score: 29.6)
    IFT43; Intraflagellar transport protein 43 (PF15305; HMM-score: 18.7)
    Dim_A_B_barrel (CL0032) DUF3291; Domain of unknown function (DUF3291) (PF11695; HMM-score: 16.6)
    TerB (CL0414) TerB; Tellurite resistance protein TerB (PF05099; HMM-score: 14.7)
    no clan definedCLAMP; Flagellar C1a complex subunit C1a-32 (PF14769; HMM-score: 14.2)
    DUF148; Domain of unknown function DUF148 (PF02520; HMM-score: 10.3)
    NTS_2; N-terminal segments of P. falciparum erythrocyte membrane protein (PF15448; HMM-score: 9.7)
    Met_repress (CL0057) DUF1778; Protein of unknown function (DUF1778) (PF08681; HMM-score: 8.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    SACOL_RS03080elongation factor Tu  [1] (data from MRSA252)
    SACOL_RS08865aldehyde dehydrogenase  [1] (data from MRSA252)
    SACOL_RS08995universal stress protein UspA  [1] (data from MRSA252)
    SACOL_RS1169530S ribosomal protein S5  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cellwall
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 9.98
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP:
  • SignalP: Signal peptide length 37 aa
    • Ymax: 0.746
    • Ymax_pos: 37
    • Cmax: 0.674
    • Cmax_pos: 37
    • Smax: 0.91
    • Smax_pos: 27
    • Smean: 0.78
    • D: 0.759
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

  • GI: 446651417 NCBI
  • RefSeq: WP_000728763 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKKKNIYSIRKLGVGIASVTLGTLLISGGVTPAANAAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDNNKPGKEDNNKPGKEDNNKPGKEDNNKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADKIAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEENPFIGTTVFGGLSLALGAALLAGRRREL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS00470 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.0 1.1 1.2 1.3

Relevant publications[edit source | edit]