From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS08545 [old locus tag: SACOL1675 ]
  • pan locus tag?: SAUPAN004218000
  • symbol: SACOL_RS08545
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS08545 [old locus tag: SACOL1675 ]
  • symbol: SACOL_RS08545
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1704671..1705339
  • length: 669
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (1704671..1705339) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGATAGATCAACAAACAATTTATCAATACATACAAAATGGAAAAATAGAAGAAGCGTTA
    CAAGCATTGTTCGGAAATATCGAAGAAAATCCTACAATTATTGAAAATTATATTAATGCT
    GGTATCGTACTTGCTGATGCGAATGAGATTGAAAAGGCAGAGCGTTTTTTCCAAAAAGCT
    TTAACAATAGATCCGAAGAATGGCGTCGTATTTTTTAATCTAGCAAATGTATATTATAAT
    CAGCAACGTTATCAAGAAGCTATTAAATTATATCAACAAGCATTACAAACAGAGATTGAA
    CAAGTTGATTGTAATTATATGATCGGTATGGCGTTTAATCAGTTAGAATCATTTAAGCTG
    GCATTGCCGTATTTAATGACTGCTGCGGAACTAGATAAAGACAAAGATGCAGAAGTTCAA
    TTTCAATATGGTCTTGTATTATGTCAATTAGAAATGTTTAATGAAGCCATAACTCAACTT
    AAACATGTATTAACGATTGATAAAAATCATGTTGATGCAAGATACAATTTGGGCTTAGCG
    TTATTTATGAAAAATGAAGATATTGATGAAGCAATAACTCATTTTAAAGAAGCTGTGACT
    ATCGACCCTAAACACTTATTAAGTCAGCATGCGCTGAAAACATTCACTAAAATGAAAGAG
    GAGGAGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    669

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS08545 [old locus tag: SACOL1675 ]
  • symbol: SACOL_RS08545
  • description: hypothetical protein
  • length: 222
  • theoretical pI: 4.41965
  • theoretical MW: 25701.1
  • GRAVY: -0.277477

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    type IV pilus biogenesis/stability protein PilW (TIGR02521; HMM-score: 72.1)
    putative PEP-CTERM system TPR-repeat lipoprotein (TIGR02917; HMM-score: 70.8)
    type III secretion low calcium response chaperone LcrH/SycD (TIGR02552; HMM-score: 56.5)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesmitochondrial precursor proteins import receptor (TIGR00990; HMM-score: 49.8)
    tol-pal system protein YbgF (TIGR02795; HMM-score: 31.4)
    putative peptide modification system cyclase (TIGR04510; HMM-score: 26.2)
    Unknown functionGeneralheme biosynthesis-associated TPR protein (TIGR00540; HMM-score: 24.5)
    pentatricopeptide repeat domain (TIGR00756; HMM-score: 21.9)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotidesadenine phosphoribosyltransferase (TIGR01090; EC 2.4.2.7; HMM-score: 21.4)
    poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA (TIGR03939; HMM-score: 20.7)
  • TheSEED:
  • PFAM:
    TPR (CL0020) TPR_1; Tetratricopeptide repeat (PF00515; HMM-score: 100)
    TPR_2; Tetratricopeptide repeat (PF07719; HMM-score: 99.7)
    TPR_8; Tetratricopeptide repeat (PF13181; HMM-score: 93.7)
    TPR_11; TPR repeat (PF13414; HMM-score: 86.9)
    TPR_12; Tetratricopeptide repeat (PF13424; HMM-score: 80.2)
    TPR_17; Tetratricopeptide repeat (PF13431; HMM-score: 64.5)
    TPR_19; Tetratricopeptide repeat (PF14559; HMM-score: 63.2)
    TPR_16; Tetratricopeptide repeat (PF13432; HMM-score: 59.9)
    TPR_14; Tetratricopeptide repeat (PF13428; HMM-score: 59.4)
    ANAPC3; Anaphase-promoting complex, cyclosome, subunit 3 (PF12895; HMM-score: 53.3)
    TPR_7; Tetratricopeptide repeat (PF13176; HMM-score: 52.4)
    TPR_10; Tetratricopeptide repeat (PF13374; HMM-score: 47.6)
    TPR_6; Tetratricopeptide repeat (PF13174; HMM-score: 42.5)
    TPR_20; Tetratricopeptide repeat (PF14561; HMM-score: 35.5)
    TOM20_plant; Plant specific mitochondrial import receptor subunit TOM20 (PF06552; HMM-score: 28.3)
    TPR_9; Tetratricopeptide repeat (PF13371; HMM-score: 28.1)
    TPR_3; Tetratricopeptide repeat (PF07720; HMM-score: 26.8)
    PPR; PPR repeat (PF01535; HMM-score: 24.8)
    TPR_15; Tetratricopeptide repeat (PF13429; HMM-score: 22.2)
    no clan definedMIT; MIT (microtubule interacting and transport) domain (PF04212; HMM-score: 21.5)
    TPR (CL0020) PPR_2; PPR repeat family (PF13041; HMM-score: 18)
    NARP1; NMDA receptor-regulated protein 1 (PF12569; HMM-score: 16.8)
    TPR_21; Tetratricopeptide repeat-like domain (PF09976; HMM-score: 16.4)
    TPR_4; Tetratricopeptide repeat (PF07721; HMM-score: 15.8)
    Hect (CL0552) HECT_2; HECT-like Ubiquitin-conjugating enzyme (E2)-binding (PF09814; HMM-score: 15.3)
    TPR (CL0020) Fis1_TPR_C; Fis1 C-terminal tetratricopeptide repeat (PF14853; HMM-score: 13)
    Clathrin; Region in Clathrin and VPS (PF00637; HMM-score: 12.1)
    Sel1; Sel1 repeat (PF08238; HMM-score: 11.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.1
    • Ymax_pos: 28
    • Cmax: 0.115
    • Cmax_pos: 46
    • Smax: 0.127
    • Smax_pos: 18
    • Smean: 0.085
    • D: 0.094
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446489174 NCBI
  • RefSeq: WP_000567028 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MIDQQTIYQYIQNGKIEEALQALFGNIEENPTIIENYINAGIVLADANEIEKAERFFQKALTIDPKNGVVFFNLANVYYNQQRYQEAIKLYQQALQTEIEQVDCNYMIGMAFNQLESFKLALPYLMTAAELDKDKDAEVQFQYGLVLCQLEMFNEAITQLKHVLTIDKNHVDARYNLGLALFMKNEDIDEAITHFKEAVTIDPKHLLSQHALKTFTKMKEEE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS08545 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]