From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS12120 [old locus tag: SACOL2304 ]
  • pan locus tag?: SAUPAN005790000
  • symbol: SACOL_RS12120
  • pan gene symbol?:
  • synonym:
  • product: YafY family transcriptional regulator

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS12120 [old locus tag: SACOL2304 ]
  • symbol: SACOL_RS12120
  • product: YafY family transcriptional regulator
  • replicon: chromosome
  • strand: +
  • coordinates: 2366944..2367636
  • length: 693
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (2366944..2367636) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAATAAAGCTGAAAGGCAAAATTTAATAATTACTGCAATTCAACAAAATAAAAAAATG
    ACCGCTTTAGAATTAGCTAAATATTGCAACGTATCCAAACGCACAATTTTAAGAGATATT
    GATGATTTAGAAAATCAAGGTGTTAAAATTTATGCGCATTATGGGAAAAATGGTGGTTAC
    CAAATACAACAAGCACAATCTAAAATTGCATTAAACTTATCTGAAACACAATTATCAGCC
    TTATTTTTAGTGCTTAATGAAAGTCAGTCGTACTCGACATTACCATATAAAAGCGAAATC
    AACGCAATTATAAAACAATGTTTAAGTCTTCCACAAACACGCTTAAGAAAATTGCTTAAA
    CGCATGGACTTTTATATTAAATTTGATGACACACAACATATGACACTCCCAATGCTGTTT
    TCCGACATTTTAATTTATTGTACAGAACGAAATGTGATGTTAGTAGATCATAGGGTTGAT
    GATAATATTAAAGCTGAAAACGTTATATTTATTGGCCTTTTGTGTAAACATGGACATTGG
    CATGCAGTCATTTATGACATTGCTCAAGACAAAACTGCCGAACTCGAAATTGAAAATATT
    ATAGATATTTCGTATTCATTCGGTAAGACGATTCAAACCAGAGACATATCCATTGATAAC
    TATCATCAATTTTTAAACCCCATCGATTCCTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    693

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS12120 [old locus tag: SACOL2304 ]
  • symbol: SACOL_RS12120
  • description: YafY family transcriptional regulator
  • length: 230
  • theoretical pI: 7.17682
  • theoretical MW: 26618.5
  • GRAVY: -0.268261

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Unknown functionGeneralRrf2 family protein (TIGR00738; HMM-score: 17.7)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairDnaD family protein (TIGR04548; HMM-score: 16.8)
    Signal transductionRegulatory functionsDNA interactionsCRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 15.5)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtherFeS assembly SUF system regulator (TIGR02944; HMM-score: 15)
    Signal transductionRegulatory functionsDNA interactionsFeS assembly SUF system regulator (TIGR02944; HMM-score: 15)
    Unknown functionGeneralDNA binding domain, excisionase family (TIGR01764; HMM-score: 14)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtheriron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 13)
    Signal transductionRegulatory functionsDNA interactionsiron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 13)
    Signal transductionRegulatory functionsDNA interactionsbiotin operon repressor (TIGR00122; HMM-score: 12.1)
  • TheSEED:
  • PFAM:
    HTH (CL0123) HTH_11; HTH domain (PF08279; HMM-score: 49.1)
    HTH_DeoR; DeoR-like helix-turn-helix domain (PF08220; HMM-score: 36.6)
    Rrf2; Transcriptional regulator (PF02082; HMM-score: 25.5)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 20.6)
    HTH_Mga; M protein trans-acting positive regulator (MGA) HTH domain (PF08280; HMM-score: 18)
    TBPIP; Tat binding protein 1(TBP-1)-interacting protein (TBPIP) (PF07106; HMM-score: 16.4)
    HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 16.3)
    HTH_AsnC-type; AsnC-type helix-turn-helix domain (PF13404; HMM-score: 14.9)
    HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 13.4)
    MarR; MarR family (PF01047; HMM-score: 13.3)
    Tn7_Tnp_TnsA_C; TnsA endonuclease C terminal (PF08721; HMM-score: 12.8)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 11.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • Ymax: 0.15
    • Ymax_pos: 23
    • Cmax: 0.126
    • Cmax_pos: 23
    • Smax: 0.206
    • Smax_pos: 15
    • Smean: 0.162
    • D: 0.154
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 446952869 NCBI
  • RefSeq: WP_001030125 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MNKAERQNLIITAIQQNKKMTALELAKYCNVSKRTILRDIDDLENQGVKIYAHYGKNGGYQIQQAQSKIALNLSETQLSALFLVLNESQSYSTLPYKSEINAIIKQCLSLPQTRLRKLLKRMDFYIKFDDTQHMTLPMLFSDILIYCTERNVMLVDHRVDDNIKAENVIFIGLLCKHGHWHAVIYDIAQDKTAELEIENIIDISYSFGKTIQTRDISIDNYHQFLNPIDS

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS12120 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]