From AureoWiki
Jump to: navigation, search

NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_02585
  • pan locus tag?: SAUPAN005790000
  • symbol: SAOUHSC_02585
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_02585
  • symbol: SAOUHSC_02585
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2377610..2378302
  • length: 693
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAATAAAGCTGAAAGGCAAAATTTAATAATTACTGCAATTCAACAAAATAAAAAAATG
    ACCGCTTTAGAATTAGCTAAATATTGCAACGTATCCAAACGCACAATTTTAAGAGATATT
    GATGATTTAGAAAATCAAGGTGTTAAAATTTATGCGCATTATGGGAAAAATGGTGGTTAC
    CAAATACAACAAGCACAATCTAAAATTGCATTAAACTTATCTGAAACACAATTATCAGCC
    TTATTTTTAGTGCTTAATGAAAGTCAGTCGTACTCGACATTACCATATAAAAGCGAAATC
    AACGCAATTATAAAACAATGTTTAAGTCTTCCACAAACACGCTTAAGAAAATTGCTTAAA
    CGCATGGACTTTTATATTAAATTTGATGACACACAACATATGACACTCCCAATGCTGTTT
    TCCGACATTTTAATTTATTGTACAGAACGAAATGTGATGTTAGTAGATCATAGGGTTGAT
    GATAATATTAAAGCTGAAAACGTTATATTTATTGGCCTTTTGTGTAAACATGGACATTGG
    CATGCAGTCATTTATGACATTGCTCAAGACAAAACTGCCGAACTCGAAATTGAAAATATT
    ATAGATATTTCGTATTCATTCGGTAAGACGATTCAAACCAGAGACATATCCATTGATAAC
    TATCATCAATTTTTAAACCCCATCGATTCCTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    693

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_02585
  • symbol: SAOUHSC_02585
  • description: hypothetical protein
  • length: 230
  • theoretical pI: 7.17682
  • theoretical MW: 26618.5
  • GRAVY: -0.268261

Function[edit source | edit]

  • TIGRFAM:
    Unknown functionGeneralRrf2 family protein (TIGR00738; HMM-score: 17.7)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairDnaD family protein (TIGR04548; HMM-score: 16.8)
    Signal transductionRegulatory functionsDNA interactionsCRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 15.5)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtherFeS assembly SUF system regulator (TIGR02944; HMM-score: 15)
    Signal transductionRegulatory functionsDNA interactionsFeS assembly SUF system regulator (TIGR02944; HMM-score: 15)
    and 4 more
    Unknown functionGeneralDNA binding domain, excisionase family (TIGR01764; HMM-score: 14)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtheriron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 13)
    Signal transductionRegulatory functionsDNA interactionsiron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 13)
    Signal transductionRegulatory functionsDNA interactionsbiotin operon repressor (TIGR00122; HMM-score: 12.1)
  • TheSEED:  
    Transcriptional regulator, DeoR family 
  • PFAM:
    HTH (CL0123) HTH_11; HTH domain (PF08279; HMM-score: 49.1)
    and 11 more
    HTH_DeoR; DeoR-like helix-turn-helix domain (PF08220; HMM-score: 36.6)
    Rrf2; Transcriptional regulator (PF02082; HMM-score: 25.5)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 20.6)
    HTH_Mga; M protein trans-acting positive regulator (MGA) HTH domain (PF08280; HMM-score: 18)
    TBPIP; Tat binding protein 1(TBP-1)-interacting protein (TBPIP) (PF07106; HMM-score: 16.4)
    HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 16.3)
    HTH_AsnC-type; AsnC-type helix-turn-helix domain (PF13404; HMM-score: 14.9)
    HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 13.4)
    MarR; MarR family (PF01047; HMM-score: 13.3)
    Tn7_Tnp_TnsA_C; TnsA endonuclease C terminal (PF08721; HMM-score: 12.8)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 11.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.15
    • Ymax_pos: 23
    • Cmax: 0.126
    • Cmax_pos: 23
    • Smax: 0.206
    • Smax_pos: 15
    • Smean: 0.162
    • D: 0.154
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNKAERQNLIITAIQQNKKMTALELAKYCNVSKRTILRDIDDLENQGVKIYAHYGKNGGYQIQQAQSKIALNLSETQLSALFLVLNESQSYSTLPYKSEINAIIKQCLSLPQTRLRKLLKRMDFYIKFDDTQHMTLPMLFSDILIYCTERNVMLVDHRVDDNIKAENVIFIGLLCKHGHWHAVIYDIAQDKTAELEIENIIDISYSFGKTIQTRDISIDNYHQFLNPIDS

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  2. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  3. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]