From AureoWiki
Jump to: navigation, search
NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS14085 [old locus tag: SACOL2691 ]
  • pan locus tag?: SAUPAN006413000
  • symbol: SACOL_RS14085
  • pan gene symbol?: icaB
  • synonym:
  • product: poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL_RS14085 [old locus tag: SACOL2691 ]
  • symbol: SACOL_RS14085
  • product: poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase
  • replicon: chromosome
  • strand: +
  • coordinates: 2764824..2765702
  • length: 879
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002951 (2764824..2765702) NCBI
  • MicrobesOnline:

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    GTGAAGTATAGAAAATTTATAATTTTAGTGTTGAGTATCTTGATCATATTGCCTGTAAGC
    ACACTGGATGGTCATCATATTGCAAATGCAGATGACGATTCACCTAAAAAACTGAAATAT
    AAAGAAAATAGTGCTCTGGCATTAAATTATCACCGTGTAAGAAAAGCGAATTTTCTGAAT
    AATTTTATTTACTTCTTTTCTAGTAGTAAAGAAATTAAAAATTATAGTGTTAGTCAATCA
    CAATTTGAATCTCAAATAAAATGGCTAAAATCACATGATGCTAAATTTTTAACCTTGAAA
    GAATTTTTATATTACAAGAAAAAAGGTAAGTTTCCAAAACGAAGTGTATGGATTAACTTT
    GATGATATGGATGAAACTATTTATGAAAATGCTTATCCAATCTTAAAAAAATATAAAATA
    CCGGCAACTGGGTTTATTATCACAGGTCATGTTGGGGAAGAAAACTTTCACAACCTCGAT
    ATGATTAGTAAAAAAGAACTAAAAGAAATGTATAAAACTGGGTTATGGGAATTTGAAACA
    CATACCCACGATTTGCATAACTTATCTAAAAATAATAAGTCAAAATTAATGAAAGCTTCT
    GAAGCTACAATCATAAAAGATTTAAACAAAAGTGAAAAATATCTAACTAAAAACTTTAAA
    AAGTCGCAGAAAACTATAGCCTATCCTTATGGCTTGATGAATGACGATAAATTACCGGTA
    ATCAAAAAAGCTGGGTTAAAATACGGTTTTTCATTAGAGGAAAAAGCAGTCACTCCGAAC
    TCCAATGATTATTACATCCCTAGAATATTAATTAGTGATGATGCTTTTGAGCATTTAATT
    AAGAGATGGGACGGATTCCATGAAAAAGATGAGACTTGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    879

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL_RS14085 [old locus tag: SACOL2691 ]
  • symbol: SACOL_RS14085
  • description: poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase
  • length: 292
  • theoretical pI: 9.88176
  • theoretical MW: 34335.3
  • GRAVY: -0.611301

Function[edit source | edit]

  • reaction:
    EC 3.5.1.-?  ExPASy
  • TIGRFAM:
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesintercellular adhesin biosynthesis polysaccharide N-deacetylase (TIGR03933; EC 3.5.1.-; HMM-score: 456.6)
    Cellular processesCellular processesPathogenesisintercellular adhesin biosynthesis polysaccharide N-deacetylase (TIGR03933; EC 3.5.1.-; HMM-score: 456.6)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidespoly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB (TIGR03938; EC 3.5.1.-; HMM-score: 110.5)
    Cellular processesCellular processesSporulation and germinationpolysaccharide deacetylase family sporulation protein PdaB (TIGR02764; HMM-score: 26.4)
    chitooligosaccharide deacetylase NodB (TIGR04243; EC 3.5.1.-; HMM-score: 17.1)
  • TheSEED:
  • PFAM:
    GH_CE (CL0158) Polysacc_deac_1; Polysaccharide deacetylase (PF01522; HMM-score: 105.1)
    no clan definedPRESAN; Plasmodium RESA N-terminal (PF09687; HMM-score: 17.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 10
    • Internal Helix: 1
  • LocateP:
  • SignalP: Signal peptide length 31 aa
    • Ymax: 0.547
    • Ymax_pos: 31
    • Cmax: 0.416
    • Cmax_pos: 31
    • Smax: 0.912
    • Smax_pos: 21
    • Smean: 0.734
    • D: 0.62
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

  • GI: 446800062 NCBI
  • RefSeq: WP_000877318 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKYRKFIILVLSILIILPVSTLDGHHIANADDDSPKKLKYKENSALALNYHRVRKANFLNNFIYFFSSSKEIKNYSVSQSQFESQIKWLKSHDAKFLTLKEFLYYKKKGKFPKRSVWINFDDMDETIYENAYPILKKYKIPATGFIITGHVGEENFHNLDMISKKELKEMYKTGLWEFETHTHDLHNLSKNNKSKLMKASEATIIKDLNKSEKYLTKNFKKSQKTIAYPYGLMNDDKLPVIKKAGLKYGFSLEEKAVTPNSNDYYIPRILISDDAFEHLIKRWDGFHEKDET

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SACOL_RS14085 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]