Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000446000
  • symbol?:
  • description?: membrane protein
  • strand?: -
  • coordinates?: 454715..456508
  • synteny block?: BlockID0001950
  • occurrence?: in 63% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0063
    08BA02176:
    11819-97:
    MS7_0071
    71193:
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_00380
    JH1:
    SaurJH1_0051
    JH9:
    SaurJH9_0050
    JKD6008:
    SAA6008_00060
    JKD6159:
    SAA6159_00040
    LGA251:
    SARLGA251_00390
    M013:
    MRSA252:
    SAR0061
    MSHR1132:
    MSSA476:
    SAS0034
    Mu3:
    SAHV_0062
    Mu50:
    SAV0063
    MW2:
    MW0040
    RF122:
    ST398:
    T0131:
    SAT0131_00059 (yycG)
    TCH60:
    HMPREF0772_10426
    TW20:
    SATW20_00940
    USA300_TCH1516:
    USA300HOU_0041
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSHHD-IFRLGLYHLDTMGWHKTIPPKKDGDEKKVVTMSSCMAVEAKFWHVLENTEKIII
    N315            MTQTNPSFNPSPRYKSKKGWYKDKPPKEKGGMPTEVEIAGPIVIENKFIDPKTNTEKVII
    USA300_FPR3757  MSYT--LFEIGPFALDSFGWKETIPPKKDGDSEKVVRMASPIIVNARFSDPITGVEKLII
                    *:     *. .    .. ** :  ***:.*.  . * ::. : :: :* .   ..**:**

    COL             SNGKDKEHTFDSDILTTRKLPSLIKYGHSINENYIKDLSYALQLMRDEMPTSDLYDGSGI
    N315            TDEDQKEIVESSDILTTQKLPSLMKYGFSINEKYTKDLGYALQQMRNQLPISYLYEGVGI
    USA300_FPR3757  TNNNGKKDIFESDILTTRNLPSLIKYGYSINEKYIRSLSYALQLMRDRLPLSELYEGVGI
                    :: . *:   .******::****:***.****:* :.*.**** **:.:* * **:* **

    COL             IETPHGYIVMIDTIYTSKQYDQLSSLDPIVDSAYPLEPKGTFKDWLNMYINEVKGHLLLE
    N315            LETPFGPIVSLSEIYTTKEFDNKSPSDAICDNAYDLTPKGTFDNWFNMYLKEVKGSLLLE
    USA300_FPR3757  LETPFGYLISLDKVLKSIQFNQSSPSYPIVDSAYDLTPKGTFDNWFNMYIDEVKGHLLLE
                    :***.* :: :. : .: :::: *.  .* *.** * *****.:*:***:.**** ****

    COL             LAVVFGISALVTSFLKYKREIEFAGIIFSFTGQSSTGKSTAAALAVSVAGNPTKGNQTLF
    N315            LAVVFGISALVTSFLKHKHETEFAGIIFSFTGQSSTGKSTAASLAVSVAGNPTKGNETLF
    USA300_FPR3757  LAVIFGISALVTSFLKHKHEIEFAGILFSFTGQSSTGKSTAAALAVSVAGNPTKGNETLF
                    ***:************:*:* *****:***************:*************:***

    COL             RSWNATRNALESYLSNNFGIPIVFDELSSATFKDTTGLLYSIAEGQGRQRSNVHGEVKTP
    N315            RNWNATRNALEGYLSNNFGIPIVFDELSSATFRDTTGLLYSITEGQGRQRSNVHGEVKTP
    USA300_FPR3757  RSWNATRNALEGYLSNNYGIPIVFDELSSTTLRDTTGLLYSIAEGQGRQRSNVHGEVKTP
                    *.*********.*****:***********:*::*********:*****************

    COL             KNWGTSVISTSEYSIFTDSAQNDGLRVRTIEINEQFTTNATNADNIKKAVALNHGHVLPL
    N315            KNWGTSVISTSEHSIFNDSAQNDGLRVRTIEINEQFTTNATNADNIKKAVALNYGHVLPL
    USA300_FPR3757  KNWGTSVISTSEYSIFNDSAQNDGLRVRTIEINEQFTTNATNADNIKKAVALNYGHVLPL
                    ************:***.************************************:******

    COL             VAQYLINREDEVIQWFYKEVDWFEAKLNSETNNTGIRMFKRYAVITTSAKILGRVLATDI
    N315            VAKYLINREDEVIQWFYKEVDWFEAKLKDDKSNTGNRMFKRYAVITTSAKILGRVLATDI
    USA300_FPR3757  VAKYLINREDEVIQWFYKEVDWFEAKLKDETNNTGIRMFKRYAVITTSAKILGRVLSTDI
                    **:************************:.:..*** ********************:***

    COL             DIAKIRDYFIDYHAHTVSERSLADKAIEVITQFVAQNRGKFSDDTALKNMFENYGLIALK
    N315            DIAKIRDYFIDYHGHTISERSLADKAIDVIIQFVAQNRGKFSDEGALKNMFENYGLISLK
    USA300_FPR3757  DIANIRDYFIDYHTHTVSERSLADKAIDVIIQFVAQNRGKFSDEGALKNMFENYGLISLK
                    ***:********* **:**********:** ************: ************:**

    COL             DNHIEVKIIASVFKNMLLEHHFQDVNNVVNALRDKGFIESDHDRITTKRTVKDGNGKKQS
    N315            DDHIEVKMIANVFKQMLNNHQFQDVNNVVNALRDKGFILADRGRQTTKRSVKDNSGKKQS
    USA300_FPR3757  DDHIEVKIIANVFKQMLNNHQFQDVNNVVNALRDKGFILADRGRQTTKRSVKDNSGKKQS
                    *:*****:**.***:** :*:***************** :*:.* ****:***..*****

    COL             LVFYHLKLDSEYASIFGLTKDAEPIKAEINLDNKKILESWKKQNDDLI------------
    N315            LVFYHLKLDVEFASILGLTKD------------KSLIQNWTPANDNKAAKELFKSANEGI
    USA300_FPR3757  LVFYHLKLDVEFASILGLTKD------------KSLLQNWTPSNDNKAAKELFKSANEGI
                    ********* *:***:*****            *.:::.*.  **:              

    COL             -------DF
    N315            GPSGVHEDF
    USA300_FPR3757  GPSGVHEDF
                           **