From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001023000
  • symbol?: argJ
  • description?: bifunctional ornithine acetyltransferase/N-acetylglutamate synthase

      descriptions from strain specific annotations:

    • bifunctional ornithine acetyltransferase/N-acetylglutamate synthase
    • bifunctional glutamate N-acetyltransferase/amino-acid N-acetyltransferase
    • bifunctional ornithine acetyltransferase/N-acetylglutamate synthase protein
    • Glutamate N-acetyltransferase / N-acetylglutamate synthase
    • putative arginine biosynthesis bifunctional protein
    • arginine biosynthesis bifunctional protein ArgJ
    • Arginine biosynthesis bifunctional protein ArgJ beta chain
    • glutamate N-acetyltransferase/amino-acid acetyltransferase
    • Ornathine acetyltransferase
  • strand?: -
  • coordinates?: 1294217..1295458
  • synteny block?: BlockID0005510
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0168 (argJ)
    N315:
    SA0177 (argJ)
    NCTC8325:
    Newman:
    NWMN_0127 (argJ)
    USA300_FPR3757:
    04-02981:
    SA2981_0184 (argJ)
    08BA02176:
    C248_0172 (argJ)
    11819-97:
    MS7_0176 (argJ)
    71193:
    ST398NM01_0198
    ECT-R 2:
    ECTR2_146 (argJ)
    ED133:
    SAOV_0127 (argJ)
    ED98:
    SAAV_0151 (argJ)
    HO 5096 0412:
    SAEMRSA15_01480 (argJ)
    JH1:
    SaurJH1_0173 (argJ)
    JH9:
    SaurJH9_0168 (argJ)
    JKD6008:
    SAA6008_00161 (argJ)
    JKD6159:
    SAA6159_00164 (argJ)
    LGA251:
    SARLGA251_01540 (argJ)
    M013:
    M013TW_0170
    MRSA252:
    SAR0184 (argJ)
    MSHR1132:
    SAMSHR1132_01560
    MSSA476:
    SAS0158 (argJ)
    Mu3:
    SAHV_0182 (argJ)
    Mu50:
    SAV0183 (argJ)
    MW2:
    MW0157 (argJ)
    RF122:
    SAB0123c (argJ)
    ST398:
    SAPIG0198 (argJ)
    T0131:
    SAT0131_00175
    TCH60:
    HMPREF0772_10316 (argJ)
    TW20:
    SATW20_01930 (argJ)
    USA300_TCH1516:
    USA300HOU_0196 (argJ)
    VC40:
    SAVC_00680 (argJ)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKHQETTSQQYNFSIIKHGDISTPQGFTAGGMHIGLRANKKDFGWIYSSSLASAAAVYTL
    N315            MKHQETTSQQYNFSIIKHGDISTPQGFTAGGMHIGLRANKKDFGWIYSSSLASSAAVYTL
    NCTC8325        MKHQETTSQQYNFSIIKHGDISTPQGFTAGGMHIGLRANKKDFGWIYSSSLASAAAVYTL
    Newman          MKHQETTSQQYNFSIIKHGDISTPQGFTAGGMHIGLRANKKDFGWIYSSSLASAAAVYTL
    USA300_FPR3757  MKHQETTSQQYNFSIIKHGDISTPQGFTAGGMHIGLRANKKDFGWIYSSSLASAAAVYTL
                    *****************************************************:******

    COL             NQFKAAPLIVTEDTLQKSKGKLQALVVNSANANSCTGQQGIDDARQTQTWVAQQLQIPSE
    N315            NQFKAAPLIVTEDTLQKSKGKLQALVVNSANANSCTGQQGIDDARQTQTWVAQQLQIPSE
    NCTC8325        NQFKAAPLIVTEDTLQKSKGKLQALVVNSANANSCTGQQGIDDARQTQTWVAQQLQIPSE
    Newman          NQFKAAPLIVTEDTLQKSKGKLQALVVNSANANSCTGQQGIDDARQTQTWVAQQLQIPSE
    USA300_FPR3757  NQFKAAPLIVTEDTLQKSKGKLQALVVNSANANSCTGQQGIDDARQTQTWVAQQLQIPSE
                    ************************************************************

    COL             HVAVASTGVIGEYLPMDKIKTGTEHIKDANFATPGAFNEAILTTDTCTKHIAVSLKIDGK
    N315            HVAVASTGVIGEYLPMDKIKTGTEHIKDTNFATPGAFNEAILTTDTCTKHIAVSLKIDGK
    NCTC8325        HVAVASTGVIGEYLPMDKIKTGTEHIKDANFATPGAFNEAILTTDTCTKHIAVSLKIDGK
    Newman          HVAVASTGVIGEYLPMDKIKTGTEHIKDANFATPGAFNEAILTTDTCTKHIAVSLKIDGK
    USA300_FPR3757  HVAVASTGVIGEYLPMDKIKTGTEHIKDANFATPGAFNEAILTTDTCTKHIAVSLKIDGK
                    ****************************:*******************************

    COL             TVTIGGSTKGSGMIHPNMATMLAFITTDASIESNTLHQLLKSSTDHTFNMITVDGDTSTN
    N315            TVTIGGSAKGSGMIHPNMATMLAFITTDASIESNTLHQLLKSSTDHTFNMITVDGDTSTN
    NCTC8325        TVTIGGSTKGSGMIHPNMATMLAFITTDASIESNTLHQLLKSSTDHTFNMITVDGDTSTN
    Newman          TVTIGGSTKGSGMIHPNMATMLAFITTDASIESNTLHQLLKSSTDHTFNMITVDGDTSTN
    USA300_FPR3757  TVTIGGSTKGSGMIHPNMATMLAFITTDASIESNTLHQLLKSSTDHTFNMITVDGDTSTN
                    *******:****************************************************

    COL             DMVLVMANHQVEHQILSQDHPQWETFVDAFNFVCTFLAKAIARDGEGATKLISVNVSGAK
    N315            DMVLVMANHQVEHQILSQDHPQWETFVDAFNFVCTFLAKAIARDGEGATKLISVNVSGAK
    NCTC8325        DMVLVMANHQVEHQILSQDHPQWETFVDAFNFVCTFLAKAIARDGEGATKLISVNVSGAK
    Newman          DMVLVMANHQVEHQILSQDHPQWETFVDAFNFVCTFLAKAIARDGEGATKLISVNVSGAK
    USA300_FPR3757  DMVLVMANHQVEHQILSQDHPQWETFVDAFNFVCTFLAKAIARDGEGATKLISVNVSGAK
                    ************************************************************

    COL             SISDARKIGKTIVSSNLVKSAIFGEDANFGRIITAIGYSGCEIDPNCTYVQLNQIPVVDK
    N315            SISDARKIGKTIVSSNLVKSAIFGEDANFGRIITAIGYSGCEIDPKCTYVQLNQIPVVDK
    NCTC8325        SISDARKIGKTIVSSNLVKSAIFGEDANFGRIITAIGYSGCEIDPNCTYVQLNQIPVVDK
    Newman          SISDARKIGKTIVSSNLVKSAIFGEDANFGRIITAIGYSGCEIDPNCTYVQLNQIPVVDK
    USA300_FPR3757  SISDARKIGKTIVSSNLVKSAIFGEDANFGRIITAIGYSGCEIDPNCTYVQLNQIPVVDK
                    *********************************************:**************

    COL             GMAVLFDEQAMSNTLTHENVTIDVQLGLGNAAATAYGCDLSYDYVRINASYRT
    N315            GMAVLFDEQAMSNTLTHEHVTIDVQLGLGNAAATAYGCDLSYDYVRINASYRT
    NCTC8325        GMAVLFDEQAMSNTLTHENVTIDVQLGLGNAAATAYGCDLSYDYVRINASYRT
    Newman          GMAVLFDEQAMSNTLTHENVTIDVQLGLGNAAATAYGCDLSYDYVRINASYRT
    USA300_FPR3757  GMAVLFDEQAMSNTLTHENVTIDVQLGLGNAAATAYGCDLSYDYVRINASYRT
                    ******************:**********************************