From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001869000
  • symbol?: mepA
  • description?: multidrug efflux MATE transporter MepA

      descriptions from strain specific annotations:

    • multidrug efflux MATE transporter MepA
    • MATE efflux family protein
    • Multidrug export protein mepA
    • MATE family multi-antimicrobial extrusion protein
    • MDR efflux family protein
    • Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps
  • strand?: +
  • coordinates?: 2364066..2365421
  • synteny block?: BlockID0012430
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0333
    08BA02176:
    C248_0389
    11819-97:
    MS7_0324 (mepA)
    71193:
    ST398NM01_0415
    ECT-R 2:
    ECTR2_294
    ED133:
    SAOV_0359
    ED98:
    SAAV_0302
    HO 5096 0412:
    SAEMRSA15_02900
    JH1:
    SaurJH1_0393
    JH9:
    SaurJH9_0383
    JKD6008:
    SAA6008_00311 (mepA)
    JKD6159:
    SAA6159_00309 (mepA)
    LGA251:
    SARLGA251_02950 (mepA)
    M013:
    M013TW_0314
    MRSA252:
    SAR0331
    MSHR1132:
    SAMSHR1132_03080
    MSSA476:
    SAS0311
    Mu3:
    SAHV_0331
    Mu50:
    SAV0334
    MW2:
    MW0311
    RF122:
    SAB0284
    ST398:
    SAPIG0415
    T0131:
    SAT0131_00339
    TCH60:
    HMPREF0772_10161 (mepA)
    TW20:
    SATW20_04020 (mepA)
    USA300_TCH1516:
    USA300HOU_0355
    VC40:
    SAVC_01420

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKDEQLYYFEKSPVFKAMMHFSLPMMIGTLLSVIYGILNIYFIGFLEDSHMISAISLTLP
    N315            MKDEQLYYFEKSPVFKAMMHFSLPMMIGTLLSVIYGILNIYFIGFLEDSHMISAISLTLP
    NCTC8325        MKDEQLYYFEKSPVFKAMMHFSLPMMIGTLLSVIYGILNIYFIGFLEDSHMISAISLTLP
    Newman          MKDEQLYYFEKSPVFKAMMHFSLPMMIGTLLSVIYGILNIYFIGFLEDSHMISAISLTLP
    USA300_FPR3757  MKDEQLYYFEKSPVFKAMMHFSLPMMIGTLLSVIYGILNIYFIGFLEDSHMISAISLTLP
                    ************************************************************

    COL             VFAILMGLGNLFGVGAGTYISRLLGAKDYSKSKFVSSFSIYGGIALGLIVILVTLPFSDQ
    N315            VFAILMGLGNLFGVGAGTYISRLLGAKDYSKSKFVSSFSIYGGIALGLIVILVTLPFSDQ
    NCTC8325        VFAILMGLGNLFGVGAGTYISRLLGAKDYSKSKFVSSFSIYGGIALGLIVILVTLPFSDQ
    Newman          VFAILMGLGNLFGVGAGTYISRLLGAKDYSKSKFVSSFSIYGGIALGLIVILVTLPFSDQ
    USA300_FPR3757  VFAILMGLGNLFGVGAGTYISRLLGAKDYSKSKFVSSFSIYGGIALGLIVILVTLPFSDQ
                    ************************************************************

    COL             IAAILGARGETLALTSNYLKVMFLSAPFVILFFILEQFARAIGAPMVSMIGMLASVGLNI
    N315            IAAILGARGETLALTSNYLKVMFLSAPFVILFFILEQFARAIGAPMISMIGMLASVGLNI
    NCTC8325        IAAILGARGETLALTSNYLKVMFLSAPFVILFFILEQFARAIGAPMVSMIGMLASVGLNI
    Newman          IAAILGARGETLALTSNYLKVMFLSAPFVILFFILEQFARAIGAPMVSMIGMLASVGLNI
    USA300_FPR3757  IAAILGARGETLALTSNYLKVMFLSAPFVILFFILEQFARAIGAPMVSMIGMLASVGLNI
                    **********************************************:*************

    COL             ILDPILIFGFDLNVVGAALGTAISNVAAALFFIIYFMKNSDVVSVNIKLAKPNKEMLSEI
    N315            ILDPILIFGFDLNVVGAALGTAISNVAAALFFIIYFMKNSDVVSVNIKLAKPNKEMLSEI
    NCTC8325        ILDPILIFGFDLNVVGAALGTAISNVAAALFFIIYFMKNSDVVSVNIKLAKPNKEMLSEI
    Newman          ILDPILIFGFDLNVVGAALGTAISNVAAALFFIIYFMKNSDVVSVNIKLAKPNKEMLSEI
    USA300_FPR3757  ILDPILIFGFDLNVVGAALGTAISNVAAALFFIIYFMKNSDVVSVNIKLAKPNKEMLSEI
                    ************************************************************

    COL             FKIGIPAFLMSILMGFTGLVLNLFLAHYGNFAIASYGISFRLVQFPELIIMGLCEGVVPL
    N315            FKIGIPAFLMSILMGFTGLVLNLFLAHYGNFAIASYGISFRLVQFPELIIMGLCEGVVPL
    NCTC8325        FKIGIPAFLMSILMGFTGLVLNLFLAHYGNFAIASYGISFRLVQFPELIIMGLCEGVVPL
    Newman          FKIGIPAFLMSILMGFTGLVLNLFLAHYGNFAIASYGISFRLVQFPELIIMGLCEGVVPL
    USA300_FPR3757  FKIGIPAFLMSILMGFTGLVLNLFLAHYGNFAIASYGISFRLVQFPELIIMGLCEGVVPL
                    ************************************************************

    COL             IAYNFMANKGRMKDVIKAVIMSIGVIFVVCMSAVFTIGHHMVGLFTTDQAIVEMATFILK
    N315            IAYNFMANKGRMKDVIKAVIMSIGVIFVVCMIAVFTIGHHMVGLFTTDQAIVEMATFILK
    NCTC8325        IAYNFMANKGRMKDVIKAVIMSIGVIFVVCMSAVFTIGHHMVGLFTTDQAIVEMATFILK
    Newman          IAYNFMANKGRMKDVIKAVIMSIGVIFVVCMSAVFTIGHHMVGLFTTDQAIVEMATFILK
    USA300_FPR3757  IAYNFMANKGRMKDVIKAVIMSIGVIFVVCMSAVFTIGHHMVGLFTTDQAIVEMATFILK
                    ******************************* ****************************

    COL             VTMASLLLNGIGFLFTGMLQATGQGRGATIMAILQGAIIIPVLFIMNALFGLTGVIWSLL
    N315            VTMASLLLNGIGFLFTGMLQATGQGRGATIMAILQGAIIIPVLFIMNALFGLTGVIWSLL
    NCTC8325        VTMASLLLNGIGFLFTGMLQATGQGRGATIMAILQGAIIIPVLFIMNALFGLTGVIWSLL
    Newman          VTMASLLLNGIGFLFTGMLQATGQGRGATIMAILQGAIIIPVLFIMNALFGLTGVIWSLL
    USA300_FPR3757  VTMASLLLNGIGFLFTGMLQATGQGRGATIMAILQGAIIIPVLFIMNALFGLTGVIWSLL
                    ************************************************************

    COL             IAESLCALAAMLIVYLLRDRLTVDTSELIEG
    N315            IAESLCALAAMLIVYLLRDRLTVDTSELIEG
    NCTC8325        IAESLCALAAMLIVYLLRDRLTVDTSELIEG
    Newman          IAESLCALAAMLIVYLLRDRLTVDTSELIEG
    USA300_FPR3757  IAESLCALAAMLIVYLLRDRLTVDTSELIEG
                    *******************************