From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002130000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 2623797..2626382
  • synteny block?: BlockID0014360
  • occurrence?: in 72% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0410
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ECTR2_369
    ED133:
    SAOV_0454
    ED98:
    SAAV_0377
    HO 5096 0412:
    JH1:
    SaurJH1_0469
    JH9:
    SaurJH9_0457
    JKD6008:
    SAA6008_00437
    JKD6159:
    LGA251:
    SARLGA251_03720
    M013:
    M013TW_0395
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS0397
    Mu3:
    SAHV_0432
    Mu50:
    SAV0434
    MW2:
    MW0395
    RF122:
    SAB0387
    ST398:
    T0131:
    SAT0131_00473
    TCH60:
    TW20:
    SATW20_05110
    USA300_TCH1516:
    USA300HOU_0436
    VC40:
    SAVC_01800

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSENFKLRKMKVGLVSVAITMLYIMTNGQAEASENQNALISNINVDNQEKQNNVNQAVQP
    N315            MRENFKLRKMKVGLVSVAITMLYIMTNGQAEASE------TNQKVSTNQESKAVSQTEQN
    NCTC8325        MRENFKLRKMKVGLVSVAITMLYIMTNGQAEASENQNALISNINVDNQEKQNNVNQAVQP
    Newman          MRENFKLRKMKVGLVSVAITMLYIMTNGQAEASENQNALISNINVDNQEKQNNVNQAVQP
    USA300_FPR3757  MRENFKLRKMKVGLVSVAITMLYIMTNGQAEASENQNALISNINVDNQEKQNNVNQAVQP
                    * ********************************      :* :*..:::.: *.*: * 

    COL             QNNTNETSKVPANFVKLNDIKPGDTSIQGTTLPNQFILLTIDKKDVSSVEDSDSSFVMSD
    N315            SKET-KAAESSKNFVNLDPIKPGAQKVTGTTLPNHIILLNIDGKSADSVEGGYGDFITAN
    NCTC8325        QNNTNETSKVPANFVKLNDIKPGDTSIQGTTLPNQFILLTIDKKDVSSVEDSDSSFVMSD
    Newman          QNNTNETSKVPANFVKLNDIKPGDTSIQGTTLPNQFILLTIDKKDVSSVEDSDSSFVMSD
    USA300_FPR3757  QNNTNETSKVPANFVKLNDIKPGDTSIQGTTLPNQFILLTIDKKDVSSVEDSDSSFVMSD
                    .::* :::: . ***:*: ****  .: ******::***.** *...***.. ..*: ::

    COL             KDGNFKYDLNGRKIVHNQEIEVSSSDPYLGDDEEDEEVEETSTEEVGAEEESTEAKATYT
    N315            DKGEFEYPLNNRKIVHNQEIEVSSSSPDLGDDEEDEEVEESSTEKAGAEEESTDAKATYT
    NCTC8325        KDGNFKYDLNGRKIVHNQEIEVSSSDPYLGDDEEDEEVEETSTEEVGAEEESTEAKATYT
    Newman          KDGNFKYDLNGRKIVHNQEIEVSSSDPYLGDDEEDEEVEETSTEEVGAEEESTEAKATYT
    USA300_FPR3757  KDGNFKYDLNGRKIVHNQEIEVSSSDPYLGDDEEDEEVEETSTEEVGAEEESTEAKATYT
                    ..*:*:* **.**************.* ************:***:.*******:******

    COL             TPRYEKAYEIPKEQLKEKDGHHQVFIEPITEGSGIIKGHTSVKGKVALSINNKFINFETN
    N315            TPRYEKAYEIPKEQLKEKDGHHQVFIEPITEGSGIIKGHTSVKGKVALSINNKFINFEER
    NCTC8325        TPRYEKAYEIPKEQLKEKDGHHQVFIEPITEGSGIIKGHTSVKGKVALSINNKFINFETN
    Newman          TPRYEKAYEIPKEQLKEKDGHHQVFIEPITEGSGIIKGHTSVKGKVALSINNKFINFETN
    USA300_FPR3757  TPRYEKAYEIPKEQLKEKDGHHQVFIEPITEGSGIIKGHTSVKGKVALSINNKFINFETN
                    ********************************************************** .

    COL             ANGGPNKEEAKSGSEGIWMPIDDKGYFNFDFKTKRFDDLELKKNDEISLTFAPDDEDEAL
    N315            AKGGISKEDTKASSDGVWMPINEKGYFDFDFKKNPFDNLELKKNDEISLTFAPDDEDEAL
    NCTC8325        ANGGPNKEEAKSGSEGIWMPIDDKGYFNFDFKTKRFDDLELKKNDEISLTFAPDDEDEAL
    Newman          ANGGPNKEEAKSGSEGIWMPIDDKGYFNFDFKTKRFDDLELKKNDEISLTFAPDDEDEAL
    USA300_FPR3757  ANGGPNKEEAKSGSEGIWMPIDDKGYFNFDFKTKRFDDLELKKNDEISLTFAPDDEDEAL
                    *:** .**::*:.*:*:****::****:****.: **:**********************

    COL             KSLIFKTKVTSLEDIDKAETKYDHTKVEKVKVLKDVKEDLHVDEIYGSLYHTEKGKGILD
    N315            KSLIFKTKVTSLEDIDKAETKYDHTKVEKVKVLKDVKEDIHVDEIYGSLYHTEKGKGILD
    NCTC8325        KSLIFKTKVTSLEDIDKAETKYDHTKVEKVKVLKDVKEDLHVDEIYGSLYHTEKGKGILD
    Newman          KSLIFKTKVTSLEDIDKAETKYDHTKVEKVKVLKDVKEDLHVDEIYGSLYHTEKGKGILD
    USA300_FPR3757  KSLIFKTKVTSLEDIDKAETKYDHTKVEKVKVLKDVKEDLHVDEIYGSLYHTEKGKGILD
                    ***************************************:********************

    COL             KEGTKVIKGKTKFANAVVKVDSELGEGQEFPDLQVDEKGEFSFDVDHAGFRLQNGETLNF
    N315            KQGTKEITGKTKFANAVVKVYSDLGDAQLFPDIQVDENGKFSFDAEKAGFRLQNGETLNF
    NCTC8325        KEGTKVIKGKTKFANAVVKVDSELGEGQEFPDLQVDEKGEFSFDVDHAGFRLQNGETLNF
    Newman          KEGTKVIKGKTKFANAVVKVDSELGEGQEFPDLQVDEKGEFSFDVDHAGFRLQNGETLNF
    USA300_FPR3757  KEGTKVIKGKTKFANAVVKVDSELGEGQEFPDLQVDEKGEFSFDVDHAGFRLQNGETLNF
                    *:*** *.************ *:**:.* ***:****:*:****.::*************

    COL             TVVDPITGELLSGNFVSKNIDIYESPEEKADREFDERMENTPAYHKLHGDKIVGYDTNGF
    N315            AVVKPITGDLLHQGFVSKYIDVYESPEEKKEREFEEKLENTPAYHKLHGDKIVGYDVQGN
    NCTC8325        TVVDPITGELLSGNFVSKNIDIYESPEEKADREFDERMENTPAYHKLHGDKIVGYDTNGF
    Newman          TVVDPITGELLSGNFVSKNIDIYESPEEKADREFDERMENTPAYHKLHGDKIVGYDTNGF
    USA300_FPR3757  TVVDPITGELLSGNFVSKNIDIYESPEEKADREFDERMENTPAYHKLHGDKIVGYDTNGF
                    :**.****:**  .**** **:******* :***:*::******************.:* 

    COL             PITWFYPLGEKKVERKAPKLEK
    N315            PSTWFYPLGEKKVERTTPKLEK
    NCTC8325        PITWFYPLGEKKVERKAPKLEK
    Newman          PITWFYPLGEKKVERKAPKLEK
    USA300_FPR3757  PITWFYPLGEKKVERKAPKLEK
                    * *************.:*****