From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003199000
  • symbol?: prfC
  • description?: peptide chain release factor 3

      descriptions from strain specific annotations:

    • peptide chain release factor 3
    • peptide chain release factor RF3
    • peptide chain release factor 3 (RF-3)
  • strand?: +
  • coordinates?: 3589850..3591458
  • synteny block?: BlockID0022860
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1025 (prfC)
    N315:
    SA0877 (prfC)
    NCTC8325:
    Newman:
    NWMN_0890 (prfC)
    USA300_FPR3757:
    04-02981:
    SA2981_0974 (prfC)
    08BA02176:
    C248_1043 (prfC)
    11819-97:
    MS7_0976 (prfC)
    71193:
    ST398NM01_1016
    ECT-R 2:
    ECTR2_875 (prfC)
    ED133:
    SAOV_0964
    ED98:
    SAAV_0982
    HO 5096 0412:
    SAEMRSA15_08500 (prfC)
    JH1:
    SaurJH1_1037 (prfC)
    JH9:
    SaurJH9_1018 (prfC)
    JKD6008:
    SAA6008_00975 (prfC)
    JKD6159:
    SAA6159_00876
    LGA251:
    SARLGA251_09350 (prfC)
    M013:
    M013TW_0945
    MRSA252:
    SAR0990 (prfC)
    MSHR1132:
    SAMSHR1132_08670
    MSSA476:
    SAS0889 (prfC)
    Mu3:
    SAHV_1014
    Mu50:
    SAV1021
    MW2:
    MW0901 (prfC)
    RF122:
    SAB0886 (prfC)
    ST398:
    SAPIG1016 (prfC)
    T0131:
    SAT0131_01055
    TCH60:
    HMPREF0772_12214 (prfC)
    TW20:
    SATW20_10170 (prfC)
    USA300_TCH1516:
    USA300HOU_0978 (prfC)
    VC40:
    SAVC_04265 (prfC)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNLKQEVESRKTFAIISHPDAGKTTLTEKLLYFSGAIREAGTVKGKKTGKFATSDWMKVE
    N315            MNLKQEVESRKTFAIISHPDAGKTTLTEKLLYFSGAIREAGTVKGKKTGKFATSDWMKVE
    NCTC8325        MNLKQEVESRKTFAIISHPDAGKTTLTEKLLYFSGAIREAGTVKGKKTGKFATSDWMKVE
    Newman          MNLKQEVESRKTFAIISHPDAGKTTLTEKLLYFSGAIREAGTVKGKKTGKFATSDWMKVE
    USA300_FPR3757  MNLKQEVESRKTFAIISHPDAGKTTLTEKLLYFSGAIREAGTVKGKKTGKFATSDWMKVE
                    ************************************************************

    COL             QERGISVTSSVMQFDYDDYKINILDTPGHEDFSEDTYRTLMAVDSAVMVIDCAKGIEPQT
    N315            QERGISVTSSVMQFDYDDYKINILDTPGHEDFSEDTYRTLMAVDSAVMVIDCAKGIEPQT
    NCTC8325        QERGISVTSSVMQFDYDDYKINILDTPGHEDFSEDTYRTLMAVDSAVMVIDCAKGIEPQT
    Newman          QERGISVTSSVMQFDYDDYKINILDTPGHEDFSEDTYRTLMAVDSAVMVIDCAKGIEPQT
    USA300_FPR3757  QERGISVTSSVMQFDYDDYKINILDTPGHEDFSEDTYRTLMAVDSAVMVIDCAKGIEPQT
                    ************************************************************

    COL             LKLFKVCKMRGIPIFTFINKLDRVGKEPFELLDEIEETLNIETYPMNWPIGMGQSFFGII
    N315            LKLFKVCKMRGIPIFTFINKLDRVGKEPFELLDEIEETLNIETYPMNWPIGMGQSFFGII
    NCTC8325        LKLFKVCKMRGIPIFTFINKLDRVGKEPFELLDEIEETLNIETYPMNWPIGMGQSFFGII
    Newman          LKLFKVCKMRGIPIFTFINKLDRVGKEPFELLDEIEETLNIETYPMNWPIGMGQSFFGII
    USA300_FPR3757  LKLFKVCKMRGIPIFTFINKLDRVGKEPFELLDEIEETLNIETYPMNWPIGMGQSFFGII
                    ************************************************************

    COL             DRKSKTIEPFRDEENILHLNDDFELEEDHAITNDSDFEQAIEELMLVEEAGEAFDNDALL
    N315            DRKSKTIEPFRDEENILHLNDDFELEEDHAITNDSAFEQAIEELMLVEEAGEAFDNDALL
    NCTC8325        DRKSKTIEPFRDEENILHLNDDFELEEDHAITNDSDFEQAIEELMLVEEAGEAFDNDALL
    Newman          DRKSKTIEPFRDEENILHLNDDFELEEDHAITNDSDFEQAIEELMLVEEAGEAFDNDALL
    USA300_FPR3757  DRKSKTIEPFRDEENILHLNDDFELEEDHAITNDSDFEQAIEELMLVEEAGEAFDNDALL
                    *********************************** ************************

    COL             SGDLTPVFFGSALANFGVQNFLNAYVDFAPMPNARQTKEDVEVSPFDDSFSGFIFKIQAN
    N315            SGDLTPVFFGSALANFGVQNFLNAYVDFAPMPNARQTKEDVEVSPFDDSFSGFIFKIQAN
    NCTC8325        SGDLTPVFFGSALANFGVQNFLNAYVDFAPMPNARQTKEDVEVSPFDDSFSGFIFKIQAN
    Newman          SGDLTPVFFGSALANFGVQNFLNAYVDFAPMPNARQTKEDVEVSPFDDSFSGFIFKIQAN
    USA300_FPR3757  SGDLTPVFFGSALANFGVQNFLNAYVDFAPMPNARQTKEDVEVSPFDDSFSGFIFKIQAN
                    ************************************************************

    COL             MDPKHRDRIAFMRVVSGAFERGMDVTLQRTNKKQKITRSTSFMADDKETVNHAVAGDIIG
    N315            MDPKHRDRIAFMRVVSGAFERGMDVTLQRTNKKQKITRSTSFMADDKETVNHAVAGDIIG
    NCTC8325        MDPKHRDRIAFMRVVSGAFERGMDVTLQRTNKKQKITRSTSFMADDKETVNHAVAGDIIG
    Newman          MDPKHRDRIAFMRVVSGAFERGMDVTLQRTNKKQKITRSTSFMADDKETVNHAVAGDIIG
    USA300_FPR3757  MDPKHRDRIAFMRVVSGAFERGMDVTLQRTNKKQKITRSTSFMADDKETVNHAVAGDIIG
                    ************************************************************

    COL             LYDTGNYQIGDTLVGGKQTYSFQDLPQFTPEIFMKVSAKNVMKQKHFHKGIEQLVQEGAI
    N315            LYDTGNYQIGDTLVGGKQTYSFQDLPQFTPEIFMKVSAKNVMKQKHFHKGIEQLVQEGAI
    NCTC8325        LYDTGNYQIGDTLVGGKQTYSFQDLPQFTPEIFMKVSAKNVMKQKHFHKGIEQLVQEGAI
    Newman          LYDTGNYQIGDTLVGGKQTYSFQDLPQFTPEIFMKVSAKNVMKQKHFHKGIEQLVQEGAI
    USA300_FPR3757  LYDTGNYQIGDTLVGGKQTYSFQDLPQFTPEIFMKVSAKNVMKQKHFHKGIEQLVQEGAI
                    ************************************************************

    COL             QYYKTLHTNQIILGAVGQLQFEVFEHRMKNEYNVDVVMEPVGRKIARWIENEDQITDKMN
    N315            QYYKTLHTNQIILGAVGQLQFEVFEHRMKNEYNVDVVMEPVGRKIARWIENEDQITDKMN
    NCTC8325        QYYKTLHTNQIILGAVGQLQFEVFEHRMKNEYNVDVVMEPVGRKIARWIENEDQITDKMN
    Newman          QYYKTLHTNQIILGAVGQLQFEVFEHRMKNEYNVDVVMEPVGRKIARWIENEDQITDKMN
    USA300_FPR3757  QYYKTLHTNQIILGAVGQLQFEVFEHRMKNEYNVDVVMEPVGRKIARWIENEDQITDKMN
                    ************************************************************

    COL             TSRSILVKDRYDDLVFLFENEFATRWFEEKFPEIKLYSLL
    N315            TSRSILVKDRYDDLVFLFENEFATRWFEEKFLEIKLYSLL
    NCTC8325        TSRSILVKDRYDDLVFLFENEFATRWFEEKFPEIKLYSLL
    Newman          TSRSILVKDRYDDLVFLFENEFATRWFEEKFPEIKLYSLL
    USA300_FPR3757  TSRSILVKDRYDDLVFLFENEFATRWFEEKFPEIKLYSLL
                    ******************************* ********