From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003359000
  • symbol?: isdA
  • description?: cell surface protein

      descriptions from strain specific annotations:

    • cell surface protein
    • iron-regulated heme-iron binding protein
    • iron transport associated domain-containing protein
    • cell wall anchor domain-containing protein
    • iron-regulated heme-iron binding protein IsdA
    • iron (Fe2+)-regulated surface determinant protein IsdA
    • LPXTG cell wall surface anchor protein
    • Cell surface protein IsdA, transfers heme from hemoglobin to apo-IsdC
    • LPXTG-motif cell wall anchor domain-containing protein
    • Iron-regulated surface determinant protein A
    • cell surface transferrin-binding protein
    • cell surface protein IsdA
    • iron-regulated surface determinant protein A (Staphylococcaltransferrin-binding protein A) (Fur-regulated protein A)
  • strand?: -
  • coordinates?: 3725253..3727066
  • synteny block?: BlockID0024420
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1140 (isdA)
    N315:
    SA0977 (isdA)
    NCTC8325:
    Newman:
    NWMN_1041 (isdA)
    USA300_FPR3757:
    04-02981:
    SA2981_1086 (isdA)
    08BA02176:
    C248_1156 (isdA)
    11819-97:
    MS7_1086 (isdA)
    71193:
    ST398NM01_1126
    ECT-R 2:
    ECTR2_984
    ED133:
    SAOV_1126c (isdB)
    ED98:
    SAAV_1096 (isdA)
    HO 5096 0412:
    SAEMRSA15_09590 (isdA)
    JH1:
    SaurJH1_1211
    JH9:
    SaurJH9_1189
    JKD6008:
    SAA6008_01084 (isdA)
    JKD6159:
    SAA6159_00984 (isdA)
    LGA251:
    SARLGA251_10420 (isdA)
    M013:
    M013TW_1061
    MRSA252:
    SAR1103 (isdA)
    MSHR1132:
    SAMSHR1132_09760
    MSSA476:
    SAS1064
    Mu3:
    SAHV_1121
    Mu50:
    SAV1130
    MW2:
    MW1012 (isdA)
    RF122:
    SAB0994c (isdB)
    ST398:
    SAPIG1126
    T0131:
    SAT0131_01169
    TCH60:
    HMPREF0772_12103 (isdA)
    TW20:
    SATW20_11240 (isdA)
    USA300_TCH1516:
    USA300HOU_1064 (isdA)
    VC40:
    SAVC_04810

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKHYLNSKYQSEQRSSAMKKITMGTASIILGSLVYIGADSQQVNAATEATNAPNNQSTQ
    N315            MTKHYLNSKYQSEQRSSAMKKITMGTASIILGSLVYIGADSQQVNAATEATNATNNQSTQ
    NCTC8325        MTKHYLNSKYQSEQRSSAMKKITMGTASIILGSLVYIGADSQQVNAATEATNATNNQSTQ
    Newman          MTKHYLNSKYQSEQRSSAMKKITMGTASIILGSLVYIGADSQQVNAATEATNATNNQSTQ
    USA300_FPR3757  MTKHYLNSKYQSEQRSSAMKKITMGTASIILGSLVYIGADSQQVNAATEATNATNNQSTQ
                    *****************************************************.******

    COL             VSQATSQPINFQVQKDGSSEKSHMDDYMQHPGKVIKQNNKYYFQTVLNNASFWKEYKFYN
    N315            VSQATSQPINFQVQKDGSSEKSHMDDYMQHPGKVIKQNNKYYFQTVLNNASFWKEYKFYN
    NCTC8325        VSQATSQPINFQVQKDGSSEKSHMDDYMQHPGKVIKQNNKYYFQTVLNNASFWKEYKFYN
    Newman          VSQATSQPINFQVQKDGSSEKSHMDDYMQHPGKVIKQNNKYYFQTVLNNASFWKEYKFYN
    USA300_FPR3757  VSQATSQPINFQVQKDGSSEKSHMDDYMQHPGKVIKQNNKYYFQTVLNNASFWKEYKFYN
                    ************************************************************

    COL             ANNQELATTVVNDNKKADTRTINVAVEPGYKSLTTKVHIVVPQINYNHRYTTHLEFEKAI
    N315            ANNQELATTVVNDNKKADTRTINVAVEPGYKSLTTKVHIVVPQINYNHRYTTHLEFEKAI
    NCTC8325        ANNQELATTVVNDNKKADTRTINVAVEPGYKSLTTKVHIVVPQINYNHRYTTHLEFEKAI
    Newman          ANNQELATTVVNDNKKADTRTINVAVEPGYKSLTTKVHIVVPQINYNHRYTTHLEFEKAI
    USA300_FPR3757  ANNQELATTVVNDNKKADTRTINVAVEPGYKSLTTKVHIVVPQINYNHRYTTHLEFEKAI
                    ************************************************************

    COL             PTLADAAKPNNVKPVQPKPAQPKTPTEQTKPVQPKVEKVKPTVTTTSKVEDNHSTKVVST
    N315            PTLADAAKPNNVKPVQPKPAQPKTPTEQTKPVQPKVEKVKPTVTTTSKVEDNHSTKVVST
    NCTC8325        PTLADAAKPNNVKPVQPKPAQPKTPTEQTKPVQPKVEKVKPTVTTTSKVEDNHSTKVVST
    Newman          PTLADAAKPNNVKPVQPKPAQPKTPTEQTKPVQPKVEKVKPTVTTTSKVEDNHSTKVVST
    USA300_FPR3757  PTLADAAKPNNVKPVQPKPAQPKTPTEQTKPVQPKVEKVKPTVTTTSKVEDNHSTKVVST
                    ************************************************************

    COL             DTTKDQTKTQTAHTVKTAQTAQEQNKVQTPVKDVATAKSESNNQAVSDNKSQQTNKVTKH
    N315            DTTKDQTKTQTAHTVKTAQTAQEQNKVQTPVKDVATAKSESNNQAVSDNKSQQTNKVTKH
    NCTC8325        DTTKDQTKTQTAHTVKTAQTAQEQNKVQTPVKDVATAKSESNNQAVSDNKSQQTNKVTKH
    Newman          DTTKDQTKTQTAHTVKTAQTAQEQNKVQTPVKDVATAKSESNNQAVSDNKSQQTNKVTKH
    USA300_FPR3757  DTTKDQTKTQTAHTVKTAQTAQEQNKVQTPVKDVATAKSESNNQAVSDNKSQQTNKVTKH
                    ************************************************************

    COL             NETPKQASKAKELPKTGLTSVDNFISTVAFATLALLGSLSLLLFKRKESK
    N315            NETPKQASKAKELPKTGLTSVDNFISTVAFATLALLGSLSLLLFKRKESK
    NCTC8325        NETPKQASKAKELPKTGLTSVDNFISTVAFATLALLGSLSLLLFKRKESK
    Newman          NETPKQASKAKELPKTGLTSVDNFISTVAFATLALLGSLSLLLFKRKESK
    USA300_FPR3757  NETPKQASKAKELPKTGLTSVDNFISTVAFATLALLGSLSLLLFKRKESK
                    **************************************************