From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003552000
  • symbol?: hslU
  • description?: ATP-dependent protease ATP-binding subunit HslU

      descriptions from strain specific annotations:

    • ATP-dependent protease ATP-binding subunit HslU
    • HslU--HslV peptidase ATPase subunit
    • ATP-dependent hsl protease ATP-binding subunit HslU
    • putative ATP-dependent protease ATP-bindingsubunit
    • ATP-dependent carboxylate-amine ligase
    • ATP-dependent endopeptidase hsl ATP-binding subunit
    • ATP-dependent protease ATPase subunit HslU
    • ATP-dependent protease ATP-binding subunit of heat shock protein
    • heat shock protein HslVU, ATPase subunit HslU
  • strand?: +
  • coordinates?: 3888423..3889835
  • synteny block?: BlockID0026290
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1271 (hslU)
    N315:
    SA1097 (hslU)
    NCTC8325:
    Newman:
    NWMN_1164 (hslU)
    USA300_FPR3757:
    04-02981:
    SA2981_1212 (clpY)
    08BA02176:
    C248_1285
    11819-97:
    MS7_1212 (hslU)
    71193:
    ST398NM01_1256
    ECT-R 2:
    ECTR2_1110 (hslU)
    ED133:
    SAOV_1256
    ED98:
    SAAV_1228 (hslU)
    HO 5096 0412:
    SAEMRSA15_10870
    JH1:
    SaurJH1_1339 (hslU)
    JH9:
    SaurJH9_1314 (hslU)
    JKD6008:
    SAA6008_01209 (hslU)
    JKD6159:
    SAA6159_01109 (hslU)
    LGA251:
    SARLGA251_11650 (HslU)
    M013:
    M013TW_1194
    MRSA252:
    SAR1230 (hslU)
    MSHR1132:
    SAMSHR1132_10970
    MSSA476:
    SAS1188 (hslU)
    Mu3:
    SAHV_1244 (hslU)
    Mu50:
    SAV1254 (hslU)
    MW2:
    MW1137 (hslU)
    RF122:
    SAB1116 (hslU)
    ST398:
    SAPIG1256 (hslU)
    T0131:
    SAT0131_01305
    TCH60:
    HMPREF0772_11976 (hslU)
    TW20:
    SATW20_12480 (HslU)
    USA300_TCH1516:
    USA300HOU_1185 (hslU)
    VC40:
    SAVC_05435 (hslU)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDTAGIRLTPKEIVSKLNEYIVGQNDAKRKVAIALRNRYRRSLLDEESKQEISPKNILMI
    N315            MDTAGIRLTPKEIVSKLNEYIVGQNDAKRKVAIALRNRYRRSLLDEESKQEISPKNILMI
    NCTC8325        MDTAGIRLTPKEIVSKLNEYIVGQNDAKRKVAIALRNRYRRSLLDEESKQEISPKNILMI
    Newman          MDTAGIRLTPKEIVSKLNEYIVGQNDAKRKVAIALRNRYRRSLLDEESKQEISPKNILMI
    USA300_FPR3757  MDTAGIRLTPKEIVSKLNEYIVGQNDAKRKVAIALRNRYRRSLLDEESKQEISPKNILMI
                    ************************************************************

    COL             GPTGVGKTEIARRMAKVVGAPFIKVEATKFTEVGYVGRDVESMVRDLVDVSVRLVKAQKK
    N315            GPTGVGKTEIARRMAKVVGAPFIKVEATKFTELGYVGRDVESMVRDLVDVSVRLVKAQKK
    NCTC8325        GPTGVGKTEIARRMAKVVGAPFIKVEATKFTEVGYVGRDVESMVRDLVDVSVRLVKAQKK
    Newman          GPTGVGKTEIARRMAKVVGAPFIKVEATKFTEVGYVGRDVESMVRDLVDVSVRLVKAQKK
    USA300_FPR3757  GPTGVGKTEIARRMAKVVGAPFIKVEATKFTEVGYVGRDVESMVRDLVDVSVRLVKAQKK
                    ********************************:***************************

    COL             SLVQDEATAKANEKLVKLLVPSMKKKASQTNNPLESLFGGAIPNFGQNNEDEEEPPTEEI
    N315            SLVQDEATAKANEKLVKLLVPSMKKKASQTNNPLESLFGGAIPNFGQNNEDEEEPPTEEI
    NCTC8325        SLVQDEATAKANEKLVKLLVPSMKKKASQTNNPLESLFGGAIPNFGQNNEDEEEPPTEEI
    Newman          SLVQDEATAKANEKLVKLLVPSMKKKASQTNNPLESLFGGAIPNFGQNNEDEEEPPTEEI
    USA300_FPR3757  SLVQDEATAKANEKLVKLLVPSMKKKASQTNNPLESLFGGAIPNFGQNNEDEEEPPTEEI
                    ************************************************************

    COL             KTKRSEIKRQLEEGKLEKEKVRIKVEQDPGALGMLGTNQNQQMQEMMNQLMPKKKVEREV
    N315            KTKRSEIKRQLEEGKLEKEKVRIKVEQDPGALGMLGTNQNQQMQEMMNQLMPKKKVEREV
    NCTC8325        KTKRSEIKRQLEEGKLEKEKVRIKVEQDPGALGMLGTNQNQQMQEMMNQLMPKKKVEREV
    Newman          KTKRSEIKRQLEEGKLEKEKVRIKVEQDPGALGMLGTNQNQQMQEMMNQLMPKKKVEREV
    USA300_FPR3757  KTKRSEIKRQLEEGKLEKEKVRIKVEQDPGALGMLGTNQNQQMQEMMNQLMPKKKVEREV
                    ************************************************************

    COL             AVETARKILADSYADELIDQESANQEALELAEQMGIIFIDEIDKVATNNHNSGQDVSRQG
    N315            AVETARKILADSYADELIDQESANQEALELAEQMGIIFIDEIDKVATNNHNSGQDVSRQG
    NCTC8325        AVETARKILADSYADELIDQESANQEALELAEQMGIIFIDEIDKVATNNHNSGQDVSRQG
    Newman          AVETARKILADSYADELIDQESANQEALELAEQMGIIFIDEIDKVATNNHNSGQDVSRQG
    USA300_FPR3757  AVETARKILADSYADELIDQESANQEALELAEQMGIIFIDEIDKVATNNHNSGQDVSRQG
                    ************************************************************

    COL             VQRDILPILEGSVIQTKYGTVNTEHMLFIGAGAFHVSKPSDLIPELQGRFPIRVELDSLS
    N315            VQRDILPILEGSVIQTKYGTVNTEHMLFIGAGAFHVSKPSDLIPELQGRFPIRVELDSLS
    NCTC8325        VQRDILPILEGSVIQTKYGTVNTEHMLFIGAGAFHVSKPSDLIPELQGRFPIRVELDSLS
    Newman          VQRDILPILEGSVIQTKYGTVNTEHMLFIGAGAFHVSKPSDLIPELQGRFPIRVELDSLS
    USA300_FPR3757  VQRDILPILEGSVIQTKYGTVNTEHMLFIGAGAFHVSKPSDLIPELQGRFPIRVELDSLS
                    ************************************************************

    COL             VEDFVRILTEPKLSLIKQYEALLQTEEVTVNFTDEAITRLAEIAYQVNQDTDNIGARRLH
    N315            VEDFVRILTEPKLSLIKQYEALLQTEEVTVNFTDEAITRLAEIAYQVNQDTDNIGARRLH
    NCTC8325        VEDFVRILTEPKLSLIKQYEALLQTEEVTVNFTDEAITRLAEIAYQVNQDTDNIGARRLH
    Newman          VEDFVRILTEPKLSLIKQYEALLQTEEVTVNFTDEAITRLAEIAYQVNQDTDNIGARRLH
    USA300_FPR3757  VEDFVRILTEPKLSLIKQYEALLQTEEVTVNFTDEAITRLAEIAYQVNQDTDNIGARRLH
                    ************************************************************

    COL             TILEKMLEDLSFEAPSMPNAVVDITPQYVDDKLKSISTNKDLSAFIL
    N315            TILEKMLEDLSFEAPSMPNAVVDITPQYVDDKLKSISTNKDLSAFIL
    NCTC8325        TILEKMLEDLSFEAPSMPNAVVDITPQYVDDKLKSISTNKDLSAFIL
    Newman          TILEKMLEDLSFEAPSMPNAVVDITPQYVDDKLKSISTNKDLSAFIL
    USA300_FPR3757  TILEKMLEDLSFEAPSMPNAVVDITPQYVDDKLKSISTNKDLSAFIL
                    ***********************************************