From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003795000
  • symbol?: pstA
  • description?: phosphate ABC transporter permease

      descriptions from strain specific annotations:

    • phosphate ABC transporter permease
    • Phosphate transport system permease protein PstA
    • phosphate ABC transporter permease PstA
    • phosphate ABC transporter ATP-binding protein
    • phosphate ABC superfamily ATP binding cassette transporter, membrane protein
    • Phosphate ABC transporter, inner membrane subunit PstA
    • phosphate ABC transporter, permease protein PstA
  • strand?: -
  • coordinates?: 4088928..4089845
  • synteny block?: BlockID0028520
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1341 (pstA)
    08BA02176:
    C248_1426
    11819-97:
    MS7_1344 (pstA)
    71193:
    ST398NM01_1388
    ECT-R 2:
    ECTR2_1244 (pstA)
    ED133:
    SAOV_1396c
    ED98:
    SAAV_1369
    HO 5096 0412:
    SAEMRSA15_12510
    JH1:
    SaurJH1_1477
    JH9:
    SaurJH9_1448
    JKD6008:
    SAA6008_01351 (pstA)
    JKD6159:
    SAA6159_01254 (pstA)
    LGA251:
    SARLGA251_13040
    M013:
    M013TW_1332
    MRSA252:
    SAR1400
    MSHR1132:
    SAMSHR1132_12290
    MSSA476:
    SAS1328
    Mu3:
    SAHV_1375
    Mu50:
    SAV1387
    MW2:
    MW1275
    RF122:
    SAB1243c
    ST398:
    SAPIG1388 (pstA)
    T0131:
    SAT0131_01459
    TCH60:
    HMPREF0772_11821 (pstA)
    TW20:
    SATW20_13860
    USA300_TCH1516:
    USA300HOU_1321 (pstA)
    VC40:
    SAVC_06180

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             METTDNNRQSLVDQQLVQKHLSSRTVKNKVFKLIFLACTLLGLVVLIALLTQTLIKGVSH
    N315            METTDNNRQSLVDQQLVQKHLSSRTVKNKVFKLIFLACTLLGLVVLIALLTQTLIKGVSH
    NCTC8325        METTDNNRQSLVDQQLVQKHLSSRTVKNKVFKLIFLACTLLGLVVLIALLTQTLIKGVSH
    Newman          METTDNNRQSLVDQQLVQKHLSSRTVKNKVFKLIFLACTLLGLVVLIALLTQTLIKGVSH
    USA300_FPR3757  METTDNNRQSLVDQQLVQKHLSSRTVKNKVFKLIFLACTLLGLVVLIALLTQTLIKGVSH
                    ************************************************************

    COL             LNLQFFTNFSSSTPSMAGVKGALIGSLWLMLSIIPLSIILGIGTAIYLEEYAKNNKFTQF
    N315            LNLQFFTNFSSSTPSMAGVKGALIGSLWLMLSIIPLSIILGIGTAIYLEEYAKNNKFTQF
    NCTC8325        LNLQFFTNFSSSTPSMAGVKGALIGSLWLMLSIIPLSIILGIGTAIYLEEYAKNNKFTQF
    Newman          LNLQFFTNFSSSTPSMAGVKGALIGSLWLMLSIIPLSIILGIGTAIYLEEYAKNNKFTQF
    USA300_FPR3757  LNLQFFTNFSSSTPSMAGVKGALIGSLWLMLSIIPLSIILGIGTAIYLEEYAKNNKFTQF
                    ************************************************************

    COL             VKISISNLAGVPSVVFGLLGYTLFVGGAGIEALKMGNSILAAALTMTLLILPIIIVSSQE
    N315            VKISISNLAGVPSVVFGLLGYTLFVGGAGIEALKMGNSILAAALTMTLLILPIIIVSSQE
    NCTC8325        VKISISNLAGVPSVVFGLLGYTLFVGGAGIEALKMGNSILAAALTMTLLILPIIIVSSQE
    Newman          VKISISNLAGVPSVVFGLLGYTLFVGGAGIEALKMGNSILAAALTMTLLILPIIIVSSQE
    USA300_FPR3757  VKISISNLAGVPSVVFGLLGYTLFVGGAGIEALKMGNSILAAALTMTLLILPIIIVSSQE
                    ************************************************************

    COL             AIRAVPNSVREASYGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVLIGIP
    N315            AIRAVPNSVREASYGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVLIGIP
    NCTC8325        AIRAVPNSVREASYGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVLIGIP
    Newman          AIRAVPNSVREASYGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVLIGIP
    USA300_FPR3757  AIRAVPNSVREASYGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVLIGIP
                    ************************************************************

    COL             TILLATPRSILDQFSALPIQIFTWAKMPQEEFQNVASAGIIVLLVILILMNGVAIILRNK
    N315            TILLATPRSILDQFSALPIQIFTWAKMPQEEFQNVASAGIIVLLVILILMNGVAIILRNK
    NCTC8325        TILLATPRSILDQFSALPIQIFTWAKMPQEEFQNVASAGIIVLLVILILMNGVAIILRNK
    Newman          TILLATPRSILDQFSALPIQIFTWAKMPQEEFQNVASAGIIVLLVILILMNGVAIILRNK
    USA300_FPR3757  TILLATPRSILDQFSALPIQIFTWAKMPQEEFQNVASAGIIVLLVILILMNGVAIILRNK
                    ************************************************************

    COL             FSKKF
    N315            FSKKF
    NCTC8325        FSKKF
    Newman          FSKKF
    USA300_FPR3757  FSKKF
                    *****