From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004078000
  • symbol?: xseA
  • description?: exodeoxyribonuclease VII large subunit

      descriptions from strain specific annotations:

    • exodeoxyribonuclease VII large subunit
    • putative exodeoxyribonuclease VII large subunit
    • exodeoxyribonuclease 7 large subunit
    • exodeoxyribonuclease VII, large subunit
  • strand?: -
  • coordinates?: 4359689..4361026
  • synteny block?: BlockID0031100
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1568 (xseA)
    N315:
    SA1354 (xseA)
    NCTC8325:
    Newman:
    NWMN_1428 (xseA)
    USA300_FPR3757:
    04-02981:
    SA2981_1482
    08BA02176:
    C248_1566
    11819-97:
    MS7_1541 (xseA)
    71193:
    ST398NM01_1589
    ECT-R 2:
    ECTR2_1375 (xseA)
    ED133:
    SAOV_1524 (xseA)
    ED98:
    SAAV_1516 (xseA)
    HO 5096 0412:
    SAEMRSA15_14440
    JH1:
    SaurJH1_1615 (xseA)
    JH9:
    SaurJH9_1582 (xseA)
    JKD6008:
    SAA6008_01493 (xseA)
    JKD6159:
    SAA6159_01459 (xseA)
    LGA251:
    SARLGA251_14300
    M013:
    M013TW_1539
    MRSA252:
    SAR1601 (xseA)
    MSHR1132:
    SAMSHR1132_13640
    MSSA476:
    SAS1462 (xseA)
    Mu3:
    SAHV_1511 (xseA)
    Mu50:
    SAV1523 (xseA)
    MW2:
    MW1476 (xseA)
    RF122:
    SAB1396c (xseA)
    ST398:
    SAPIG1589 (xseA)
    T0131:
    SAT0131_01617 (gltD)
    TCH60:
    HMPREF0772_11617 (xseA)
    TW20:
    SATW20_15200
    USA300_TCH1516:
    USA300HOU_1525 (xseA)
    VC40:
    SAVC_06865 (xseA)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSDYLSVSALTKYIKYKFDQDPHLQSVLIKGELSNFKKHSSGHLYFNVKDKESVISAMMF
    N315            MSDYLSVSALTKYIKYKFDQDPHLQSVLIKGELSNFKKHSSGHLYFNVKDKESVISAMMF
    NCTC8325        MSDYLSVSALTKYIKYKFDQDPHLQSVLIKGELSNFKKHSSGHLYFNVKDKESVISAMMF
    Newman          MSDYLSVSALTKYIKYKFDQDPHLQSVLIKGELSNFKKHSSGHLYFNVKDKESVISAMMF
    USA300_FPR3757  MSDYLSVSALTKYIKYKFDQDPHLQSVLIKGELSNFKKHSSGHLYFNVKDKESVISAMMF
                    ************************************************************

    COL             KGSASKLNFEPKEGDEVLLEARVSVFERRGNYQIYVNKMQLDGIGNLYQKLEALKKKLTE
    N315            KGSASKLNFEPKEGDEVLLEARVSVFERRGNYQIYVNKMQLDGIGNLYQKLEALKKKLTE
    NCTC8325        KGSASKLNFEPKEGDEVLLEARVSVFERRGNYQIYVNKMQLDGIGNLYQKLEALKKKLTE
    Newman          KGSASKLNFEPKEGDEVLLEARVSVFERRGNYQIYVNKMQLDGIGNLYQKLEALKKKLTE
    USA300_FPR3757  KGSASKLNFEPKEGDEVLLEARVSVFERRGNYQIYVNKMQLDGIGNLYQKLEALKKKLTE
                    ************************************************************

    COL             EGCFDKANKKSIPKFPKKIAVLTASTGAAIRDIHSTINSRFPLAEQIQISTLVQGEKAKD
    N315            EGCFDKANKKSIPKFPKKIAVLTASTGAAIRDIHSTINSRFPLAEQIQISTLVQGEKAKD
    NCTC8325        EGCFDKANKKSIPKFPKKIAVLTASTGAAIRDIHSTINSRFPLAEQIQISTLVQGEKAKD
    Newman          EGCFDKANKKSIPKFPKKIAVLTASTGAAIRDIHSTINSRFPLAEQIQISTLVQGEKAKD
    USA300_FPR3757  EGCFDKANKKSIPKFPKKIAVLTASTGAAIRDIHSTINSRFPLAEQIQISTLVQGEKAKD
                    ************************************************************

    COL             DIIEKIEYADSLGVDTIIVGRGGGSIEDLWNFNEEAVVRAIYNCKTPIISAVGHETDFTL
    N315            DIIEKIEYADSLGVDTIIVGRGGGSIEDLWNFNEEAVVRAIYNCKTPIISAVGHETDFTL
    NCTC8325        DIIEKIEYADSLGVDTIIVGRGGGSIEDLWNFNEEAVVRAIYNCKTPIISAVGHETDFTL
    Newman          DIIEKIEYADSLGVDTIIVGRGGGSIEDLWNFNEEAVVRAIYNCKTPIISAVGHETDFTL
    USA300_FPR3757  DIIEKIEYADSLGVDTIIVGRGGGSIEDLWNFNEEAVVRAIYNCKTPIISAVGHETDFTL
                    ************************************************************

    COL             SDFAADIRAATPTQAAVIATPDQYELLQQIQQYQFTLTRFIKKHLEQQRKHVEHLSSYYK
    N315            SDFAADIRAATPTQAAVIATPDQYELLQQIQQYQFTLTRFIKKHLEQQRKHVEHLSSYYK
    NCTC8325        SDFAADIRAATPTQAAVIATPDQYELLQQIQQYQFTLTRFIKKHLEQQRKHVEHLSSYYK
    Newman          SDFAADIRAATPTQAAVIATPDQYELLQQIQQYQFTLTRFIKKHLEQQRKHVEHLSSYYK
    USA300_FPR3757  SDFAADIRAATPTQAAVIATPDQYELLQQIQQYQFTLTRFIKKHLEQQRKHVEHLSSYYK
                    ************************************************************

    COL             FKQPTLLYDQQIQRRDDLEKRLKQQIQATFEQQRHRLMLLQQRYNLKALLSSVNQEQQNN
    N315            FKQPTLLYDQQIQRRDDLEKRLKQQIQATFEQQRHRLMLLQQRYNLKALLSSVNQEQQNN
    NCTC8325        FKQPTLLYDQQIQRRDDLEKRLKQQIQATFEQQRHRLMLLQQRYNLKALLSSVNQEQQNN
    Newman          FKQPTLLYDQQIQRRDDLEKRLKQQIQATFEQQRHRLMLLQQRYNLKALLSSVNQEQQNN
    USA300_FPR3757  FKQPTLLYDQQIQRRDDLEKRLKQQIQATFEQQRHRLMLLQQRYNLKALLSSVNQEQQNN
                    ************************************************************

    COL             LQLTNQLVKLLNSKILSYKNDLKNKVENLNNLSPTNTMLRGYAIVNKKDEVITSTKDLTE
    N315            LQLTNQLVKLLNSKILSYKNDLKNKVENLNNLSPTNTMLRGYAIVNKKDEVITSTKDLTE
    NCTC8325        LQLTNQLVKLLNSKILSYKNDLKNKVENLNNLSPTNTMLRGYAIVNKKDEVITSTKDLTE
    Newman          LQLTNQLVKLLNSKILSYKNDLKNKVENLNNLSPTNTMLRGYAIVNKKDEVITSTKDLTE
    USA300_FPR3757  LQLTNQLVKLLNSKILSYKNDLKNKVENLNNLSPTNTMLRGYAIVNKKDEVITSTKDLTE
                    ************************************************************

    COL             NDQLTLTMKDGLVDAKVTKVRCNND
    N315            NDQLTLTMKDGLVDAKVTKVRCNND
    NCTC8325        NDQLTLTMKDGLVDAKVTKVRCNND
    Newman          NDQLTLTMKDGLVDAKVTKVRCNND
    USA300_FPR3757  NDQLTLTMKDGLVDAKVTKVRCNND
                    *************************