From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004347000
  • symbol?: accA
  • description?: acetyl-CoA carboxylase carboxyltransferase subunit alpha

      descriptions from strain specific annotations:

    • acetyl-CoA carboxylase carboxyltransferase subunit alpha
    • acetyl-coenzyme A carboxylase carboxyltransferase subunit alpha
    • Acetyl-coenzyme A carboxyl transferase alpha chain
    • acetyl-CoA carboxylase, carboxyl transferase, alpha subunit
    • acetyl-CoA carboxylase, carboxyl transferase subunit alpha
  • strand?: -
  • coordinates?: 4586995..4587939
  • synteny block?: BlockID0033520
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1747 (accA)
    N315:
    SA1522 (accA)
    NCTC8325:
    Newman:
    NWMN_1594 (accA)
    USA300_FPR3757:
    04-02981:
    SA2981_1658 (accA)
    08BA02176:
    C248_1741 (accA)
    11819-97:
    MS7_1706 (accA)
    71193:
    ST398NM01_1753
    ECT-R 2:
    ECTR2_1539 (accA)
    ED133:
    SAOV_1687 (accA)
    ED98:
    SAAV_1709 (accA)
    HO 5096 0412:
    SAEMRSA15_16090 (accA)
    JH1:
    SaurJH1_1790
    JH9:
    SaurJH9_1756
    JKD6008:
    SAA6008_01668 (accA)
    JKD6159:
    SAA6159_01623 (accA)
    LGA251:
    SARLGA251_15910 (accA)
    M013:
    M013TW_1712
    MRSA252:
    SAR1778 (accA)
    MSHR1132:
    SAMSHR1132_15500
    MSSA476:
    SAS1627
    Mu3:
    SAHV_1686 (accA)
    Mu50:
    SAV1700 (accA)
    MW2:
    MW1643 (accA)
    RF122:
    SAB1558c (accA)
    ST398:
    SAPIG1753 (accA)
    T0131:
    SAT0131_01803
    TCH60:
    HMPREF0772_11452 (accA)
    TW20:
    SATW20_16910 (accA)
    USA300_TCH1516:
    USA300HOU_1686 (accA)
    VC40:
    SAVC_07710

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLDFEKPLFEIRNKIESLKESQDKNDVDLQEEIDMLEASLERETKKIYTNLKPWDRVQIA
    N315            MLDFEKPLFEIRNKIESLKESQDKNDVDLQEEIDMLEASLERETKKIYTNLKPWDRVQIA
    NCTC8325        MLDFEKPLFEIRNKIESLKESQDKNDVDLQEEIDMLEASLERETKKIYTNLKPWDRVQIA
    Newman          MLDFEKPLFEIRNKIESLKESQDKNDVDLQEEIDMLEASLERETKKIYTNLKPWDRVQIA
    USA300_FPR3757  MLDFEKPLFEIRNKIESLKESQDKNDVDLQEEIDMLEASLERETKKIYTNLKPWDRVQIA
                    ************************************************************

    COL             RLQERPTTLDYIPYIFDSFMELHGDRNFRDDPAMIGGIGFLNGRAVTVIGQQRGKDTKDN
    N315            RLQERPTTLDYIPYIFDSFMELHGDRNFRDDPAMIGGIGFLNGRAVTVIGQQRGKDTKDN
    NCTC8325        RLQERPTTLDYIPYIFDSFMELHGDRNFRDDPAMIGGIGFLNGRAVTVIGQQRGKDTKDN
    Newman          RLQERPTTLDYIPYIFDSFMELHGDRNFRDDPAMIGGIGFLNGRAVTVIGQQRGKDTKDN
    USA300_FPR3757  RLQERPTTLDYIPYIFDSFMELHGDRNFRDDPAMIGGIGFLNGRAVTVIGQQRGKDTKDN
                    ************************************************************

    COL             IYRNFGMAHPEGYRKALRLMKQAEKFNRPIFTFIDTKGAYPGKAAEERGQSESIATNLIE
    N315            IYRNFGMAHPEGYRKALRLMKQAEKFNRPIFTFIDTKGAYPGKAAEERGQSESIATNLIE
    NCTC8325        IYRNFGMAHPEGYRKALRLMKQAEKFNRPIFTFIDTKGAYPGKAAEERGQSESIATNLIE
    Newman          IYRNFGMAHPEGYRKALRLMKQAEKFNRPIFTFIDTKGAYPGKAAEERGQSESIATNLIE
    USA300_FPR3757  IYRNFGMAHPEGYRKALRLMKQAEKFNRPIFTFIDTKGAYPGKAAEERGQSESIATNLIE
                    ************************************************************

    COL             MASLKVPVIAIVIGEGGSGGALGIGIANKVLMLENSTYSVISPEGAAALLWKDSNLAKIA
    N315            MASLKVPVIAIVIGEGGSGGALGIGIANKVLMLENSTYSVISPEGAAALLWKDSNLAKIA
    NCTC8325        MASLKVPVIAIVIGEGGSGGALGIGIANKVLMLENSTYSVISPEGAAALLWKDSNLAKIA
    Newman          MASLKVPVIAIVIGEGGSGGALGIGIANKVLMLENSTYSVISPEGAAALLWKDSNLAKIA
    USA300_FPR3757  MASLKVPVIAIVIGEGGSGGALGIGIANKVLMLENSTYSVISPEGAAALLWKDSNLAKIA
                    ************************************************************

    COL             AETMKITAHDIKQLGIIDDVISEPLGGAHKDIEQQALAIKSAFVAQLDSLESLSRDEIAN
    N315            AETMKITAHDIKQLGIIDDVISEPLGGAHKDVEQQALAIKSAFVAQLDSLESLSRDEIAN
    NCTC8325        AETMKITAHDIKQLGIIDDVISEPLGGAHKDIEQQALAIKSAFVAQLDSLESLSRDEIAN
    Newman          AETMKITAHDIKQLGIIDDVISEPLGGAHKDIEQQALAIKSAFVAQLDSLESLSRDEIAN
    USA300_FPR3757  AETMKITAHDIKQLGIIDDVISEPLGGAHKDIEQQALAIKSAFVAQLDSLESLSRDEIAN
                    *******************************:****************************

    COL             DRFEKFRNIGSYIE
    N315            DRFEKFRNIGSYIE
    NCTC8325        DRFEKFRNIGSYIE
    Newman          DRFEKFRNIGSYIE
    USA300_FPR3757  DRFEKFRNIGSYIE
                    **************