From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004935000
  • symbol?: pcrB
  • description?: geranylgeranylglyceryl phosphate synthase

      descriptions from strain specific annotations:

    • geranylgeranylglyceryl phosphate synthase
    • geranylgeranylglyceryl phosphate synthase-like protein
    • (S)-3-O-geranylgeranylglyceryl phosphate synthase
    • geranylgeranylglyceryl phosphate synthase family protein
    • protein PcrB
    • geranylgeranylglyceryl diphosphate synthase
    • PcrB family protein
    • putative glycerol-1-phosphate prenyltransferase
    • PcrB family replication protein
    • Phosphoglycerol geranylgeranyltransferase
  • strand?: -
  • coordinates?: 5126096..5126788
  • synteny block?: BlockID0038400
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1722 (pcrB)
    NCTC8325:
    Newman:
    NWMN_1844 (pcrB)
    USA300_FPR3757:
    04-02981:
    SA2981_1863 (pcrB)
    08BA02176:
    C248_1981 (pcrB)
    11819-97:
    MS7_1941 (pcrB)
    71193:
    ST398NM01_2000
    ECT-R 2:
    ECTR2_1778
    ED133:
    SAOV_2008
    ED98:
    SAAV_1972
    HO 5096 0412:
    SAEMRSA15_18130 (pcrB)
    JH1:
    SaurJH1_1995
    JH9:
    SaurJH9_1961
    JKD6008:
    SAA6008_01927 (pcrB)
    JKD6159:
    SAA6159_01837 (pcrB)
    LGA251:
    SARLGA251_17910 (pcrB)
    M013:
    M013TW_1943
    MRSA252:
    SAR1998 (pcrB)
    MSHR1132:
    SAMSHR1132_17510
    MSSA476:
    SAS1829
    Mu3:
    SAHV_1891 (pcrB)
    Mu50:
    SAV1906 (pcrB)
    MW2:
    MW1847 (pcrB)
    RF122:
    SAB1841c
    ST398:
    SAPIG2000
    T0131:
    SAT0131_02033 (smpB)
    TCH60:
    HMPREF0772_11236 (pcrB)
    TW20:
    SATW20_19010 (pcrB)
    USA300_TCH1516:
    USA300HOU_1907 (pcrB)
    VC40:
    SAVC_08790

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MYDIKKWRHIFKLDPAKHISDDDLDAICMSQTDAIMIGGTDDVTEDNVIHLMSRVRRYPL
    N315            MYDIKKWRHIFKLDPAKHISDDDLDAICMSQTDAIMIGGTDDVTEDNVIHLMSRIRRYPL
    NCTC8325        MYDIKKWRHIFKLDPAKHISDDDLDAICMSQTDAIMIGGTDDVTEDNVIHLMSRVRRYPL
    Newman          MYDIKKWRHIFKLDPAKHISDDDLDAICMSQTDAIMIGGTDDVTEDNVIHLMSRVRRYPL
    USA300_FPR3757  MYDIKKWRHIFKLDPAKHISDDDLDAICMSQTDAIMIGGTDDVTEDNVIHLMSRVRRYPL
                    ******************************************************:*****

    COL             PLVLEISNIESVMPGFDFYFVPTVLNSTDVVFHNGTLLEALKTYGHSIDFEEVIFEGYVV
    N315            PLVLEISNIESVMPGFDFYFVPTVLNSTDVAFHNGTLLEALKTYGHSIDFEEVIFEGYVV
    NCTC8325        PLVLEISNIESVMPGFDFYFVPTVLNSTDVVFHNGTLLEALKTYGHSIDFEEVIFEGYVV
    Newman          PLVLEISNIESVMPGFDFYFVPTVLNSTDVVFHNGTLLEALKTYGHSIDFEEVIFEGYVV
    USA300_FPR3757  PLVLEISNIESVMPGFDFYFVPTVLNSTDVVFHNGTLLEALKTYGHSIDFEEVIFEGYVV
                    ******************************.*****************************

    COL             CNADSKVAKHTKANTDLTTEDLEAYAQMVNHMYRLPVMYIEYSGIYGDVSKVQAVSEHLT
    N315            CNADSKVAKHTKANTDLTTEDLEAYAQMVNHMYRLPVMYIEYSGIYGDVSKVQAVSEHLT
    NCTC8325        CNADSKVAKHTKANTDLTTEDLEAYAQMVNHMYRLPVMYIEYSGIYGDVSKVQAVSEHLT
    Newman          CNADSKVAKHTKANTDLTTEDLEAYAQMVNHMYRLPVMYIEYSGIYGDVSKVQAVSEHLT
    USA300_FPR3757  CNADSKMAKHTKANTDLTTEDLEAYAQMVNHMYRLPVMYIEYSGIYGDVSKVQAVSEHLT
                    ******:*****************************************************

    COL             ETQLFYGGGISSEQQATEMAAIADTIIVGDIIYKDIKKALKTVKIKESSK
    N315            ETQLFYGGGISSEQQATEMAAIADTIIVGDIIYKDIKKALKTVKIKESSK
    NCTC8325        ETQLFYGGGISSEQQATEMAAIADTIIVGDIIYKDIKKALKTVKIKESSK
    Newman          ETQLFYGGGISSEQQATEMAAIADTIIVGDIIYKDIKKALKTVKIKESSK
    USA300_FPR3757  ETQLFYGGGISSEQQATEMAAIADTIIVGDIIYKDIKKALKTVKIKESSK
                    **************************************************