From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005188000
  • symbol?: int3
  • description?: integrase

      descriptions from strain specific annotations:

    • integrase
    • site-specific integrase
    • phage integrase
    • bacteriophage integrase
    • DNA integration/recombination/inversion protein
    • Integrase, phage associated
    • phage integrase family protein
  • strand?: +
  • coordinates?: 5356471..5357532
  • synteny block?: BlockID0040200
  • occurrence?: in 72% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1810 (int)
    NCTC8325:
    Newman:
    NWMN_1925 (int)
    USA300_FPR3757:
    04-02981:
    SA2981_1964
    08BA02176:
    11819-97:
    MS7_2034
    71193:
    ST398NM01_0469
    ECT-R 2:
    ECTR2_1874
    ED133:
    ED98:
    SAAV_2070
    HO 5096 0412:
    SAEMRSA15_19260 (int)
    JH1:
    SaurJH1_2097
    JH9:
    SaurJH9_2060
    JKD6008:
    SAA6008_02056
    JKD6159:
    SAA6159_01937
    LGA251:
    M013:
    MRSA252:
    SAR2105 (int)
    MSHR1132:
    SAMSHR1132_18450
    MSSA476:
    SAS1922
    Mu3:
    SAHV_1988 (int)
    Mu50:
    SAV2002 (int)
    MW2:
    MW1939 (int)
    RF122:
    ST398:
    T0131:
    SAT0131_02138
    TCH60:
    TW20:
    SATW20_20000 (int)
    USA300_TCH1516:
    USA300HOU_2009 (int)
    VC40:

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            --------MKTRCYDGKKWQYEFKHEGKRYRKKGFRTKREANSAGLDKLNELRSGFNIDN
    NCTC8325        --------MKTRCYDGKKWQYEFKHEGKRYRKKGFRTKREANSAGLDKLNELRSGFNIDN
    Newman          MPILRRERMKTRCYDGKKWQYEFKHEGKRYRKKGFRTKREANSAGLDKLNELRSGFNIDN
    USA300_FPR3757  --------MKTRCYDGKKWQYEFKYEGKRYRKKGFRTKREANSAGLDKLNELRSGFNIDN
                            ****************:***********************************

    N315            YITLEEYFENWIKTYKQPVVKENTYRHYRNALQHIQKHKIGKMELSKINRQVYQKFINDH
    NCTC8325        YITLAEYFENWIKTYKQPVVKENTYRHYRNALQHIQKHKIGKMELSKINRQVYQKFINDY
    Newman          YITLEEYFENWIKTYKQPVVKENTYRHYRNALQHIQKHKIGKMELSKINRQVYQKFINDY
    USA300_FPR3757  YITLEEYFENWIKTYKQPVVKENTYRHYRNALQHIQKHKIGKMELSKINRQVYQKFINDY
                    **** ******************************************************:

    N315            SKEHAKETIRKTNGAIRSALDDALYDGLIFKNPAYKVNYKAGKPTKSEQEKFISVTEYEI
    NCTC8325        SKEHAKETIRKTNGAIRSALDDALYDGLIFKNPAYKVNYKAGKPTKSEQEKFISVTEYEI
    Newman          SKEHAKETIRKTNGAIRSALDDALYDGLIFKNPAYKVNYKAGKPTKSEQEKFISVTEYEI
    USA300_FPR3757  SKEHAKETIRKTNGAIRSALDDALYDGLIFKNPAYKVNYKAGKPTKSEQEKFISVTEYEI
                    ************************************************************

    N315            LKDHVRKKRTRSSLALFIMICTGCRVSGARNIKIEHINQVKNTIFIDERKTDTSPRYISI
    NCTC8325        LKDHVRKKRTRSSLALFIMICTGCRVSGARNIKIEHINQVKNTIFIDERKTDTSPRYISI
    Newman          LKDHVRKKRTRSSLALFIMICTGCRVSGARNIKIEHINQVKNTIFIDERKTNTSPRYISI
    USA300_FPR3757  LKDHVRKKRTRSSLALFIMICTGCRVSGARNIKIEHINQVKNTIFIDERKTDTSPRYISI
                    ***************************************************:********

    N315            AKSDMKHIMDVISTFAISYDGYIFKEAGSIINLQAINNALKSACRVNNIPIITSHALRHT
    NCTC8325        AKSDMKHIMDVISTFAISYDGYIFKEAGSIINLQAINNALKSACRVNNIPIITSHALRHT
    Newman          AKSDMKHIMDVISTFAISYDGYIFKEGGSIINLHAINNALKSACRVNNIPIITSHALRHT
    USA300_FPR3757  AKSDMKHIMDVISTFAISYDGYIFKEAGSIINLHAINNALKSACRVNNISIITSHALRHT
                    **************************.******:***************.**********

    N315            HCSYLLAKGVSIHYISKRLGHKNIAITTSVYSHLLEEKFNEEDKKTTKILESM
    NCTC8325        HCSYLLAKGVSIHYISKRLGHKNIAITTSVYSHLLEEKFNEEDKKTTKILESM
    Newman          HCSYLLAKGVSIHYISKRLGHKNIAITTSVYSHLLEEKFNEEDKKTTKILESM
    USA300_FPR3757  HCSYLLAKGVSIHYISKRLGHKNIAITTSVYSHLLEEKFNEEDKKTTKILESM
                    *****************************************************