From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005408000
  • symbol?: prmC
  • description?: protoporphyrinogen oxidase

      descriptions from strain specific annotations:

    • protoporphyrinogen oxidase
    • HemK family modification methylase
    • Methylase of polypeptide chain release factors
    • protein-(glutamine-N5) methyltransferase
    • modification methylase HemK family protein
    • HemK family methyltransferase
    • N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
    • protein-(glutamine-N5) methyltransferase, release factor-specific
    • peptide release factor-glutamine N5-methyltransferase
    • methylase of polypeptide chain release factor
  • strand?: -
  • coordinates?: 5567977..5568729
  • synteny block?: BlockID0042040
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2057
    08BA02176:
    C248_2131
    11819-97:
    MS7_2133 (prmC)
    71193:
    ST398NM01_2159
    ECT-R 2:
    ECTR2_1973 (hemK)
    ED133:
    SAOV_2158c
    ED98:
    SAAV_2172
    HO 5096 0412:
    SAEMRSA15_20250
    JH1:
    SaurJH1_2191
    JH9:
    SaurJH9_2153
    JKD6008:
    SAA6008_02155
    JKD6159:
    SAA6159_02031
    LGA251:
    SARLGA251_19180
    M013:
    M013TW_2076
    MRSA252:
    SAR2205
    MSHR1132:
    SAMSHR1132_19400
    MSSA476:
    SAS2020
    Mu3:
    SAHV_2101
    Mu50:
    SAV2117
    MW2:
    MW2041
    RF122:
    SAB2001c
    ST398:
    SAPIG2159 (hemK)
    T0131:
    SAT0131_02280
    TCH60:
    HMPREF0772_11074 (prmC)
    TW20:
    SATW20_22550
    USA300_TCH1516:
    USA300HOU_2105
    VC40:
    SAVC_09460

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVNYKEKLDEAIHLTQQKGFEQTRAEWLMLDVFQWTRTDFVVHMHDDMPKAMIMKFDLAL
    N315            MVNYKEKLDEAIHLTQQKGFEQTRAEWLMLDVFQWTRTDFVVHMHDDMPKAMIMKFDLAL
    NCTC8325        ----------------------------MLDVFQWTRTDFVVHMHDDMPKAMIMKFDLAL
    Newman          MVNYKEKLDEAIHLTQQKGFEQTRAEWLMLDVFQWTRTDFVVHMHDDMPKAMIMKFDLAL
    USA300_FPR3757  ----------------------------MLDVFQWTRTDFVVHMHDDMPKAMIMKFDLAL
                                                ********************************

    COL             QRMLLGEPIQYIVGFASFYGRTFDVNSNCLIPRPETEEVMLHFLQQLEDDATIVDIGTGS
    N315            QRMLLGEPIQYIVGFASFYGRTFDVNSNCLIPRPETEEVMLHFLQQLEDDATIVDIGTGS
    NCTC8325        QRMLLGEPIQYIVGFASFYGRTFDVNSNCLIPRPETEEVMLHFLQQLEDDATIVDIGTGS
    Newman          QRMLLGEPIQYIVGFASFYGRTFDVNSNCLIPRPETEEVMLHFLQQLEDDATIVDIGTGS
    USA300_FPR3757  QRMLLGEPIQYIVGFASFYGRTFDVNSNCLIPRPETEEVMLHFLQQLEDDATIVDIGTGS
                    ************************************************************

    COL             GVLAITLKCEKPDLNVIATDISLEAMNMARNNAEKHQSQIQFLTGDALKPLINEGIKLNG
    N315            GVLAITLKCEKPDLNVIATDISLEAMNMARNNAEKHQSQIQFLTGDALKPLIKEGIKLNG
    NCTC8325        GVLAITLKCEKPDLNVIATDISLEAMNMARNNAEKHQSQIQFLTGDALKPLINEGIKLNG
    Newman          GVLAITLKCEKPDLNVIATDISLEAMNMARNNAEKHQSQIQFLTGDALKPLINEGIKLNG
    USA300_FPR3757  GVLAITLKCEKPDLNVIATDISLEAMNMARNNAEKHQSQIQFLTGDALKPLINEGIKLNG
                    ****************************************************:*******

    COL             LISNPPYIDEKDMVTMSPTVTRFEPHQALFADNHGYAIYESIIEDLPHVMEKGSPVVFEI
    N315            LISNPPYIDEKDMVTMSPTVTRFEPHQALFADNHGYAIYESIIGDLPHVMEKGSPVVFEI
    NCTC8325        LISNPPYIDEKDMVTMSPTVTRFEPHQALFADNHGYAIYESIIEDLPHVMEKGSPVVFEI
    Newman          LISNPPYIDEKDMVTMSPTVTRFEPHQALFADNHGYAIYESIIEDLPHVMEKGSPVVFEI
    USA300_FPR3757  LISNPPYIDEKDMVTMSPTVTRFEPHQALFADNHGYAIYESIIEDLPHVMEKGSPVVFEI
                    ******************************************* ****************

    COL             GYNQGEALKSIILNKFPDKKIDIIKDINGHDRIVSFKW
    N315            GYNQGEALKSIILNKFPDKKIDIIKDINGHDRIVSFKW
    NCTC8325        GYNQGEALKSIILNKFPDKKIDIIKDINGHDRIVSFKW
    Newman          GYNQGEALKSIILNKFPDKKIDIIKDINGHDRIVSFKW
    USA300_FPR3757  GYNQGEALKSIILNKFPDKKIDIIKDINGHDRIVSFKW
                    **************************************