From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005496000
  • symbol?: mtlR
  • description?: PTS lactose transporter subunit IIB

      descriptions from strain specific annotations:

    • PTS lactose transporter subunit IIB
    • BglG family transcriptional antiterminator
    • transcriptional antiterminator BglG family protein
    • putative transcriptional regulator
    • bglG family mannitol operon activator
    • Mannitol operon activator, BglG family
    • PRD domain-containing protein
    • PTS system, Lactose/Cellobiose specific IIB subunit
    • PTS system mannitol (Cryptic)-specific transporter subunit IIA
    • putative transcriptional antiterminator
    • Transcriptional antiterminator
    • transcriptional antiterminator, BglG family/DNA-binding protein
    • transcriptional antiterminator BglG
    • transcription antiterminator
  • strand?: +
  • coordinates?: 5652695..5654643
  • synteny block?: BlockID0042780
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2096
    08BA02176:
    C248_2185
    11819-97:
    MS7_2172
    71193:
    ST398NM01_2211
    ECT-R 2:
    ECTR2_2010
    ED133:
    SAOV_2196
    ED98:
    SAAV_2211
    HO 5096 0412:
    SAEMRSA15_20630
    JH1:
    SaurJH1_2227
    JH9:
    SaurJH9_2189
    JKD6008:
    SAA6008_02193 (bglG)
    JKD6159:
    SAA6159_02066 (bglG)
    LGA251:
    SARLGA251_19530
    M013:
    M013TW_2115
    MRSA252:
    SAR2245
    MSHR1132:
    SAMSHR1132_19890
    MSSA476:
    SAS2058
    Mu3:
    SAHV_2141
    Mu50:
    SAV2157
    MW2:
    MW2083
    RF122:
    SAB2037
    ST398:
    SAPIG2211
    T0131:
    SAT0131_02320
    TCH60:
    HMPREF0772_11036
    TW20:
    SATW20_22920
    USA300_TCH1516:
    USA300HOU_2147 (bglG)
    VC40:
    SAVC_09650

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLLSTREKEMIALLIKYHGQYITIHDIAQQLAVSSRTIHRELKGVEAYLTSFSLTLERAN
    N315            MLLSTREKEMIALLIKYHSQYITIHDIAQQLAVSSRTIHRELKGVEAYLTSFSLTLERAN
    NCTC8325        MLLSTREKEMIALLIKYHGQYITIHDIAQQLAVSSRTIHRELKGVEAYLTSFSLTLERAN
    Newman          MLLSTREKEMIALLIKYHGQYITIHDIAQQLAVSSRTIHRELKGVEAYLTSFSLTLERAN
    USA300_FPR3757  MLLSTREKEMIALLIKYHGQYITIHDIAQQLAVSSRTIHRELKGVEAYLTSFSLTLERAN
                    ******************.*****************************************

    COL             KKGLRIAGTDSDLNDLKQSIAQHQTIDLSVEEQKVIIIYALIQAKEPVKQYSLAQEIGVS
    N315            KKGLRIAGADSDLNDLKQSIAQHQTIDLSVEEQKVIIIYALIQAKEPVKQYSLAQEIGVS
    NCTC8325        KKGLRIAGTDSDLNDLKQSIAQHQTIDLSVEEQKVIIIYALIQAKEPVKQYSLAQEIGVS
    Newman          KKGLRIAGTDSDLNDLKQSIAQHQTIDLSVEEQKVIIIYALIQAKEPVKQYSLAQEIGVS
    USA300_FPR3757  KKGLRIAGTDSDLNDLKQSIAQHQTIDLSVEEQKVIIIYALIQAKEPVKQYSLAQEIGVS
                    ********:***************************************************

    COL             VQTLAKMLDDLELDLNKYQLSLSRKRGEGIYLVGTESKKREFLSQLMVNNLNSTSVYSVI
    N315            VQTLAKMLDDLELDLNKYQLSLSRKRGEGIYLVGTESKKREFLSQLMVNNLNSTSVYSVI
    NCTC8325        VQTLAKMLDDLELDLNKYQLSLSRKRGEGIYLVGTESKKREFLSQLMVNNLNSTSVYSVI
    Newman          VQTLAKMLDDLELDLNKYQLSLSRKRGEGIYLVGTESKKREFLSQLMVNNLNSTSVYSVI
    USA300_FPR3757  VQTLAKMLDDLELDLNKYQLSLSRKRGEGIYLVGTESKKREFLSQLMVNNLNSTSVYSVI
                    ************************************************************

    COL             ENHFVFHSLNQIHKDFVDLERIFNVERLLMDYLSALPYQLTESSYLTLTVHIVLSISRIK
    N315            ENHFVFHSLNQIHKDFVDLERIFNVERLLMDYLSALPYQLTESSYLTLTVHIVLSISRIK
    NCTC8325        ENHFVFHSLNQIHKDFVDLERIFNVERLLMDYLSALPYQLTESSYLTLTVHIVLSISRIK
    Newman          ENHFVFHSLNQIHKDFVDLERIFNVERLLMDYLSALPYQLTESSYLTLTVHIVLSISRIK
    USA300_FPR3757  ENHFVFHSLNQIHKDFVDLERIFNVERLLMDYLSALPYQLTESSYLTLTVHIVLSISRIK
                    ************************************************************

    COL             NGEYVALNDDIYDSVQNTFEHKVASELADKLGQIYDVTFNQAEIAFITIHLRGAKRKNLN
    N315            NGEYVALNDDIYDSVQNTFEHKVASELADKLGQIYDVTFNQAEIAFITIHLRGAKRKNLN
    NCTC8325        NGEYVALNDDIYDSVQNTFEHKVASELADKLGQIYDVTFNQAEIAFITIHLRGAKRKNLN
    Newman          NGEYVALNDDIYDSVQNTFEHKVASELADKLGQIYDVTFNQAEIAFITIHLRGAKRKNLN
    USA300_FPR3757  NGEYVALNDDIYDSVQNTFEHKVASELADKLGQIYDVTFNQAEIAFITIHLRGAKRKNLN
                    ************************************************************

    COL             DTSLNNRCEENKIKAFVNKVEMISGMTFADLDTLVDGLTLHLNPAINRLQANIETYNPLT
    N315            DTSLNNRCEENKIKAFVNKVEMISGMTFADLDTLVDGLTLHLNPAINRLQANIETYNPLT
    NCTC8325        DTSLNNRCEENKIKAFVNKVEMISGMTFADLDTLVDGLTLHLNPAINRLQANIETYNPLT
    Newman          DTSLNNRCEENKIKAFVNKVEMISGMTFADLDTLVDGLTLHLNPAINRLQANIETYNPLT
    USA300_FPR3757  DTSLNNRCEENKIKAFVNKVEMISGMTFADLDTLVDGLTLHLNPAINRLQANIETYNPLT
                    ************************************************************

    COL             DMIKFKYPRLFENVRLALNDCWPDLIFPESEIAFIVLHFGGSIKNQGNRFLNILVVCSSG
    N315            DMIKFKYPRLFENVRLALNDCWPDLIFPESEIAFIVLHFGGSIKNQGNRFLNILVVCSSG
    NCTC8325        DMIKFKYPRLFENVRLALNDCWPDLIFPESEIAFIVLHFGGSIKNQGNRFLNILVVCSSG
    Newman          DMIKFKYPRLFENVRLALNDCWPDLIFPESEIAFIVLHFGGSIKNQGNRFLNILVVCSSG
    USA300_FPR3757  DMIKFKYPRLFENVRLALNDCWPDLIFPESEIAFIVLHFGGSIKNQGNRFLNILVVCSSG
                    ************************************************************

    COL             MGTSRLLSTRLEQVFSEIERITQASVSDLKSLDLSQYDGIISTVNLDIDSPYLTVNPLLP
    N315            MGTSRLLSTRLEQVFSEIERITQASVSDLKSLDLSQYDGIISTVNLDIDSPYLTVNPLLP
    NCTC8325        MGTSRLLSTRLEQVFSEIERITQASVSDLKSLDLSQYDGIISTVNLDIDSPYLTVNPLLP
    Newman          MGTSRLLSTRLEQVFSEIERITQASVSDLKSLDLSQYDGIISTVNLDIDSPYLTVNPLLP
    USA300_FPR3757  MGTSRLLSTRLDQVFSEIERITQASVSDLKSLDLSQYDGIISTVNLDIDSPYLTVNPLLP
                    ***********:************************************************

    COL             DSDISYVAQFLNTKSTFQETHDKSSNMIDKDDVHVETKDVDGNTSFENEQTSYLTSVFEK
    N315            DSDISYVAQFLNTKSTFQETHDKSSNMIDKDDVHVETKDVDGNTSFENEQTSYLTSVFEK
    NCTC8325        DSDISYVAQFLNTKSTFQETHDKSSNMIDKDDVHVETKDVDGNTSFENEQTSYLTSVFEK
    Newman          DSDISYVAQFLNTKSTFQETHDKSSNMIDKDDVHVETKDVDGNTSFENEQTSYLTSVFEK
    USA300_FPR3757  DSDISYVAQFLNTKSTFQETHDKSSNMIDKDDVHVETKDVDGNTSFENEQTSYLTSVFEK
                    ************************************************************

    COL             HLSDEKSEQLLHHMRSGLTLLDSVKIVSTEVKQWQTYIADYLYQCDVINDPTSFAELLEQ
    N315            HLSDEKSEQLLHHMRSGLTLLDSVKIVSTEVKQWQTYIADYLYQCDVINDPTSFAELLEQ
    NCTC8325        HLSDEKSEQLLHHMRSGLTLLDSVKIVSTEVKQWQTYIADYLYQCDVINDPTSFAELLEQ
    Newman          HLSDEKSEQLLHHMRSGLTLLDSVKIVSTEVKQWQTYIADYLYQCDVINDPTSFAELLEQ
    USA300_FPR3757  HLSDEKSEQLLHHMRSGLTLLDSVKIVSTEVKQWQTYIADYLYQCDVINDPTSFAELLEQ
                    ************************************************************

    COL             RLIDNPGWILSPYPVAIPHLRDNMIKHPMILITVLEEPLTLPSIQNDNQTIKYMISMFIS
    N315            RLIDNPGWILSPYPVAIPHLRDNMIKHPMILITVLEEPLTLPSIQNDNQTIKYMISMFIP
    NCTC8325        RLIDNPGWILSPYPVAIPHLRDNMIKHPMILITVLEEPLTLPSIQNDNQTIKYMISMFIS
    Newman          RLIDNPGWILSPYPVAIPHLRDNMIKHPMILITVLEEPLTLPSIQNDNQTIKYMISMFIS
    USA300_FPR3757  RLIDNPGWILSPYPVAIPHLRDNMIKHPMILITVLEEPLTLPSIQNDNQTIKYMISMFIS
                    ***********************************************************.

    COL             DNDFMASLVSDLSEFLSLKLESIDTFMENPQELETLLRNKFLERIKKQFI
    N315            DNDFMASLVSDLSEFLSLKLESIDTFMENPQELETLLRNKFLERIKKQFI
    NCTC8325        DNDFMASLVSDLSEFLSLKLESIDTFMENPQELETLLRNKFLERIKKQFI
    Newman          DNDFMASLVSDLSEFLSLKLESIDTFMENPQELETLLRNKFLERIKKQFI
    USA300_FPR3757  DNDFMASLVSDLSEFLSLKLESIDTFMENPQELETLLRNKFLERIKKQFI
                    **************************************************