From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005722000
  • symbol?:
  • description?: MarR family transcriptional regulator

      descriptions from strain specific annotations:

    • MarR family transcriptional regulator
    • MarR family regulatory protein
    • marR family protein
    • HTH-type transcriptional regulator
    • transcriptional regulator, MarR family
  • strand?: +
  • coordinates?: 5827475..5827915
  • synteny block?: BlockID0044680
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2203
    08BA02176:
    C248_2302
    11819-97:
    MS7_2284
    71193:
    ST398NM01_2316
    ECT-R 2:
    ECTR2_2126
    ED133:
    SAOV_2303
    ED98:
    SAAV_2328
    HO 5096 0412:
    SAEMRSA15_21630
    JH1:
    SaurJH1_2332
    JH9:
    SaurJH9_2290
    JKD6008:
    SAA6008_02302
    JKD6159:
    SAA6159_02170
    LGA251:
    SARLGA251_20490
    M013:
    M013TW_2223
    MRSA252:
    SAR2349
    MSHR1132:
    SAMSHR1132_20900
    MSSA476:
    SAS2155
    Mu3:
    SAHV_2249
    Mu50:
    SAV2265
    MW2:
    MW2183
    RF122:
    SAB2137
    ST398:
    SAPIG2316
    T0131:
    SAT0131_02440
    TCH60:
    HMPREF0772_10935
    TW20:
    SATW20_23970
    USA300_TCH1516:
    USA300HOU_2246 (marR)
    VC40:
    SAVC_10185

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLSQEFFNSFITIYRPYLKLAEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEK
    N315            MLSQEFFNSFITIYRPYLKLAEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEK
    NCTC8325        MLSQEFFNSFITIYRPYLKLAEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEK
    Newman          MLSQEFFNSFITIYRPYLKLAEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEK
    USA300_FPR3757  MLSQEFFNSFITIYRPYLKLAEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEK
                    ************************************************************

    COL             PTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNI
    N315            PTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNI
    NCTC8325        PTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNI
    Newman          PTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNI
    USA300_FPR3757  PTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNI
                    ************************************************************

    COL             SQDQMQETINVMNQIHEILLKEAHND
    N315            SQDQMQETINVMNQIHEILLKEAHND
    NCTC8325        SQDQMQETINVMNQIHEILLKEAHND
    Newman          SQDQMQETINVMNQIHEILLKEAHND
    USA300_FPR3757  SQDQMQETINVMNQIHEILLREAHND
                    ********************:*****