From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005744000
  • symbol?: bioY
  • description?: biotin transporter BioY

      descriptions from strain specific annotations:

    • biotin transporter BioY
    • BioY family protein
    • biotin biosynthesis BioY family protein
    • biotin biosynthesis protein
    • Bioy
    • BioY protein
    • ECF transporter substrate-specific protein BioY
    • Substrate-specific component BioY of biotin ECF transporter
    • transmembranal protein BioY
    • transmembrane protein BioY
  • strand?: -
  • coordinates?: 5842365..5842939
  • synteny block?: BlockID0044900
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2220 (bioY)
    08BA02176:
    C248_2320
    11819-97:
    MS7_2301 (bioY)
    71193:
    ST398NM01_2333
    ECT-R 2:
    ECTR2_2143
    ED133:
    SAOV_2321c
    ED98:
    SAAV_2345
    HO 5096 0412:
    SAEMRSA15_21800
    JH1:
    SaurJH1_2349
    JH9:
    SaurJH9_2307
    JKD6008:
    SAA6008_02319
    JKD6159:
    SAA6159_02187
    LGA251:
    SARLGA251_20660
    M013:
    M013TW_2240
    MRSA252:
    SAR2366
    MSHR1132:
    SAMSHR1132_21080
    MSSA476:
    SAS2172
    Mu3:
    SAHV_2266
    Mu50:
    SAV2282
    MW2:
    MW2200
    RF122:
    SAB2154c
    ST398:
    SAPIG2333
    T0131:
    SAT0131_02460 (isdE)
    TCH60:
    HMPREF0772_10916
    TW20:
    SATW20_24140
    USA300_TCH1516:
    USA300HOU_2264
    VC40:
    SAVC_10275

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTTKQLVYTALMTAIIAILGLVPVIPLPFSSVPIVLQNIGIFLAGVILGRKYGTLSVIVF
    N315            MTTKQLVYTALMTAIIAILGMVPVIPLPFSSVPIVLQNIGIFLAGVILGRKYGTLSVIVF
    NCTC8325        MTTKQLVYTALMTAIIAILGLVPVIPLPFSSVPIVLQNIGIFLAGAILGRKYGTLSVIVF
    Newman          MTTKQLVYTALMTAIIAILGLVPVIPLPFSSVPIVLQNIGIFLAGVILGRKYGTLSVIVF
    USA300_FPR3757  MTTKQLVYTALMTAIIAILGLVPVIPLPFSSVPIVLQNIGIFLAGVILGRKYGTLSVIVF
                    ********************:************************.**************

    COL             LLLVVAGLPLLSGGRGGIGVFAGPSAGFLLLYPVVAFMIGAIRDRFINEINFWILFVGIL
    N315            LLLVVAGLPLLSGGRGGIGVFAGPSAGFLLLYPVVAFMIGAIRDRFINEINFWILFVGIL
    NCTC8325        LLLVVAGLPLLSGGRGGIGVFAGPSAGFLLLYPVVAFMIGAIRDRFINEINFWILFVGIL
    Newman          LLLVVAGLPLLSGGRGGIGVFAGPSAGFLLLYPVVAFMIGAIRDRFINEINFWILFVGIL
    USA300_FPR3757  LLLVVAGLPLLSGGRGGIGVFAGPSAGFLLLYPVVAFMIGAIRDRFINEINFWILFVGIL
                    ************************************************************

    COL             VFGVIALDVIGTLIMGMIINIPFTKAISISLAYLPGDILKAIVASLIGTALLNHSQFRQI
    N315            VFGVIALDVIGTLIMGMIINIPFTKAISISLAYLPGDILKAIVASLIGTALLNHSQFRQI
    NCTC8325        VFGVIALDVIGTLIMGMIINIPFTKAISISLAYLPGDILKAIVASLIGTALLNHSQFRQI
    Newman          VFGVIALDVIGTLIMGMIINIPFTKAISISLAYLPGDILKAIVASLIGTALLNHSQFRQI
    USA300_FPR3757  VFGVIALDVIGTLIMGMIINIPFTKAISISLAYLPGDILKAIVASLIGTALLNHSQFRQI
                    ************************************************************

    COL             MGIK
    N315            MGLK
    NCTC8325        MGIK
    Newman          MGIK
    USA300_FPR3757  MGIK
                    **:*