From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006148000
  • symbol?:
  • description?: drug transporter

      descriptions from strain specific annotations:

    • drug transporter
    • multidrug resistance transporter protein
    • major facilitator transporter
    • Major Facilitator Superfamily protein
    • MFS family major facilitator transporter
    • drug transporter, putative
    • multidrug-efflux transporter
    • Bicyclomycin resistance protein
  • strand?: -
  • coordinates?: 6220011..6221320
  • synteny block?: BlockID0048790
  • occurrence?: in 56% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    C248_2568 (yvmA)
    11819-97:
    MS7_2517
    71193:
    ST398NM01_2564
    ECT-R 2:
    ED133:
    SAOV_2556c
    ED98:
    HO 5096 0412:
    SAEMRSA15_24100
    JH1:
    JH9:
    JKD6008:
    SAA6008_02549
    JKD6159:
    SAA6159_02408
    LGA251:
    SARLGA251_22870
    M013:
    MRSA252:
    MSHR1132:
    SAMSHR1132_23330
    MSSA476:
    Mu3:
    Mu50:
    MW2:
    RF122:
    ST398:
    SAPIG2564
    T0131:
    SAT0131_02714
    TCH60:
    TW20:
    SATW20_26330
    USA300_TCH1516:
    USA300HOU_2501
    VC40:
    SAVC_11435

Genome Viewer[edit source | edit]

COL chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MINSNIRLYILGFLAFFASLIQNIYTPIIPRLYDDFQVPLFWINATVGGFIFIVAVMQIV
    NCTC8325        MINSNIRLYILGFLAFFASLIQNIYTPIIPRLYDDFQVPLFWINATVGGFIFIVAVMQIV
    Newman          MINSNIRLYILGFLAFFASLIQNIYTPIIPRLYDDFQVPLFWINATVGGFIFIVAVMQIV
    USA300_FPR3757  MINSNIRLYILGFLAFFASLIQNIYTPIIPRLYDDFQVPLFWINATVGGFIFIVAVMQIV
                    ************************************************************

    COL             LGRSIDSRDSKKVLLTGLGIVIISSFICAVTHNFILFAISRLFQAIGCGIIPLVTLTLLA
    NCTC8325        LGRSIDSRDSKKVLLTGLGIVIISSFICAVTHNFILFAISRLFQAIGCGIIPLVTLTLLA
    Newman          LGRSIDSRDSKKVLLTGLGIVIISSFICAVTHNFILFAISRLFQAIGCGIIPLVTLTLLA
    USA300_FPR3757  LGRSIDSRDSKKVLLTGLGIVIISSFICAVTHNFILFAISRLFQAIGCGIIPLVTLTLLA
                    ************************************************************

    COL             KLSTDNGRAQAMANYQIFLSCAPALAPILGSTLGARWDYIGIFSFLLVISIVLFLIIFFI
    NCTC8325        KLSTDNGRAQAMANYQIFLSCAPALAPILGSTLGARWDYIGIFSFLLVISIVLFLIIFFI
    Newman          KLSTDNGRAQAMANYQIFLSCAPALAPILGSTLGARWDYIGIFSFLLVISIVLFLIIFFI
    USA300_FPR3757  KLSTDNGRAQAMANYQIFLSCAPALAPILGSTLGARWDYIGIFSFLLVISIVLFLIIFFI
                    ************************************************************

    COL             DIPNVEKGIVKLTEKIEEKYLTDKVFITLVTLGFLIFFTYFSILVYLPTLLNNTYDIGVG
    NCTC8325        DIPNVEKGIVKLTEKIEEKYLTDKVFITLVTLGFLIFFTYFSILVYLPTLLNNTYDIGVG
    Newman          DIPNVEKGIVKLTEKIEEKYLTDKVFITLVTLGFLIFFTYFSILVYLPTLLNNTYDIGVG
    USA300_FPR3757  DIPNVEKGIVKLTEKIEEKYLTDKVFITLVTLGFLIFFTYFSILVYLPTLLNNTYDIGVG
                    ************************************************************

    COL             ISGVLFLPITVSVILGSLFYKRFSKKYNEIMILRVTITGFAIFTLLFGWLNESNVIILSV
    NCTC8325        ISGVLFLPITVSVILGSLFYKRFSKKYNEIMILRVTITGFAIFTLLFGWLNESNVIILSV
    Newman          ISGVLFLPITVSVILGSLFYKRFSKKYNEIMILRVTITGFAIFTLLFGWLNESNVIILSV
    USA300_FPR3757  ISGVLFLPITVSVILGSLFYKRFSKKYNEIMILRVTITGFAIFTLLFGWLNESNVIILSV
                    ************************************************************

    COL             IIFILGTCVGIVPALLSTIISKRFEHIKGKVLGVFNFVRYIGMTVGALLIGIISQPLVAF
    NCTC8325        IIFILGTCVGIVPALLSTIISKRFEHIKGKVLGVFNFVRYIGMTVGALLIGIISQPLVAF
    Newman          IIFILGTCVGIVPALLSTIISKRFEHIKGKVLGVFNFVRYIGMTVGALLIGIISQPLVAF
    USA300_FPR3757  IIFILGTCVGIVPALLSTIISKRFEHIKGKVLGVFNFVRYIGMTVGALLIGIISQPLVAF
                    ************************************************************

    COL             YFTTITIMLIVIFLYIKIVDFQLKYAK
    NCTC8325        YFTTITIMLIVIFLYIKIVDFQLKYAK
    Newman          YFTTITIMLIVIFLYIKIVDFQLKYAK
    USA300_FPR3757  YFTTITIMLIVIFLYIKIVDFQLKYAK
                    ***************************