From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006337000
  • symbol?: nsaS
  • description?: two-component sensor histidine kinase

      descriptions from strain specific annotations:

    • two-component sensor histidine kinase
    • integral membrane sensor signal transduction histidine kinase
    • ATPase
    • sensor histidine kinase, putative
    • Putative two-component sensor histidine kinase
    • histidine kinase-, DNA gyrase B-, and HSP90-like ATPase family protein
    • nisin susceptibility-associated sensor histidine kinase
    • sensor kinase
    • sensor kinase protein
  • strand?: -
  • coordinates?: 6378307..6379194
  • synteny block?: BlockID0050530
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2645 (nsaS)
    N315:
    NCTC8325:
    Newman:
    NWMN_2523 (nsaS)
    USA300_FPR3757:
    04-02981:
    SA2981_2563
    08BA02176:
    C248_2691
    11819-97:
    MS7_2629
    71193:
    ST398NM01_2673
    ECT-R 2:
    ECTR2_2478
    ED133:
    SAOV_2672c
    ED98:
    SAAV_2692
    HO 5096 0412:
    SAEMRSA15_25280
    JH1:
    SaurJH1_2703
    JH9:
    SaurJH9_2647
    JKD6008:
    SAA6008_02683
    JKD6159:
    SAA6159_02520
    LGA251:
    SARLGA251_23960
    M013:
    M013TW_2603
    MRSA252:
    SAR2702
    MSHR1132:
    SAMSHR1132_24400
    MSSA476:
    SAS2510
    Mu3:
    SAHV_2608
    Mu50:
    SAV2624
    MW2:
    MW2544
    RF122:
    SAB2499c
    ST398:
    SAPIG2673
    T0131:
    SAT0131_02887
    TCH60:
    HMPREF0772_10565
    TW20:
    SATW20_27620
    USA300_TCH1516:
    USA300HOU_2623 (nsaS)
    VC40:
    SAVC_11990

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTFLKSITQEIAIVIVIFALFGLMFYLYHLPLEAYLLALGVILLLLLIFIGIKYLSFVKT
    N315            MTFLKSITQEIAIVIVIFALFGLMFYLYHLPLEAYLLALGVILLLLLIFIGIKYLSFVKT
    NCTC8325        MTFLKSITQEIAIVIVIFALFGLMFYLYHLPLEAYLLALGVILLLLLIFIGIKYLSFVKT
    Newman          MTFLKSITQEIAIVIVIFALFGLMFYLYHLPLEAYLLALGVILLLLLIFIGIKYLSFVKT
    USA300_FPR3757  MTFLKSITQEIAIVIVIFALFGLMFYLYHLPLEAYLLALGVILLLLLIFIGIKYLSFVKT
                    ************************************************************

    COL             ISQQQQIENLENALYQLKNEQIEYKNDVESYFLTWVHQMKTPITAAQLLLERDEPNVVNR
    N315            ISQQQQIENLETALYQLKNEQIEYKNDVESYFLTWVHQMKTPITAAQLLLERDEPNVVNR
    NCTC8325        ISQQQQIENLENALYQLKNEQIEYKNDVESYFLTWVHQMKTPITAAQLLLERDEPNVVNR
    Newman          ISQQQQIENLENALYQLKNEQIEYKNDVESYFLTWVHQMKTPITAAQLLLERDEPNVVNR
    USA300_FPR3757  ISQQQQIENLENALYQLKNEQIEYKNDVESYFLTWVHQMKTPITAAQLLLERDEPNVVNR
                    ***********.************************************************

    COL             VRQEVIQIDNYTSLALSYLKLLNETSDISVTKISINNIIRPIIMKYSIQFIDQKTKIHYE
    N315            VRQEVIQIDNYTSLALSYLKLLNETSDISVTKISINNIIRPIIMKYSIQFIDQKTKIHYE
    NCTC8325        VRQEVIQIDNYTSLALSYLKLLNETSDISVTKISINNIIRPIIMKYSIQFIDQKTKIHYE
    Newman          VRQEVIQIDNYTSLALSYLKLLNETSDISVTKISINNIIRPIIMKYSIQFIDQKTKIHYE
    USA300_FPR3757  VRQEVIQIDNYTSLALSYLKLLNETSDISVTKISINNIIRPIIMKYSIQFIDQKTKIHYE
                    ************************************************************

    COL             PCHHEVLTDVRWTSLMIEQLINNALKYARGKDIWIEFDEQSNQLHVKDNGIGISEADLPK
    N315            PCHHEVLTDVRWTSLMIEQLINNALKYARGKDIWIEFDEQSNQLHVKDNGIGISEADLPK
    NCTC8325        PCHHEVLTDVRWTSLMIEQLINNALKYARGKDIWIEFDEQSNQLHVKDNGIGISEADLPK
    Newman          PCHHEVLTDVRWTSLMIEQLINNALKYARGKDIWIEFDEQSNQLHVKDNGIGISEADLPK
    USA300_FPR3757  PCHHEVLTDVRWTSLMIEQLINNALKYARGKDIWIEFDEQSNQLHVKDNGIGISEADLPK
                    ************************************************************

    COL             IFDKGYSGYNGQRQSNSSGIGLFIVKQISTHTNHPVSVVSKQNEGTTFTIQFPDE
    N315            IFDKGYSGYNGQRQSNSSGIGLFIVKQISTHTNHPVSVVSKQNEGTTFTIQFPDE
    NCTC8325        IFDKGYSGYNGQRQSNSSGIGLFIVKQISTHTNHPVSVVSKQNEGTTFTIQFPDE
    Newman          IFDKGYSGYNGQRQSNSSGIGLFIVKQISTHTNHPVSVVSKQNEGTTFTIQFPDE
    USA300_FPR3757  IFDKGYSGYNGQRQSNSSGIGLFIVKQISTHTNHPVSVVSKQNEGTTFTIQFPDE
                    *******************************************************