From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006459000
  • symbol?: nixA
  • description?: high-affinity nickel-transport protein

      descriptions from strain specific annotations:

    • high-affinity nickel-transport protein
    • high-affinity nickel-transporter
    • HoxN/HupN/NixA family nickel/cobalt transporter
    • high-affinity nickel-transport protein nixA
    • nickel-cobalt transporter
    • nickel transport protein
    • putative nickel transport protein
    • NiCoT family nickel (Ni2+)-cobalt (Co2+) transporter
  • strand?: +
  • coordinates?: 6503913..6504966
  • synteny block?: BlockID0051660
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2721 (nixA)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2637
    08BA02176:
    C248_2764
    11819-97:
    MS7_2703 (nixA)
    71193:
    ST398NM01_2744
    ECT-R 2:
    ECTR2_2550
    ED133:
    SAOV_2741
    ED98:
    SAAV_2770 (nixA)
    HO 5096 0412:
    SAEMRSA15_25970
    JH1:
    SaurJH1_2778
    JH9:
    SaurJH9_2721
    JKD6008:
    SAA6008_02755 (nixA)
    JKD6159:
    SAA6159_02592 (nixA)
    LGA251:
    SARLGA251_24640
    M013:
    M013TW_2680
    MRSA252:
    SAR2778
    MSHR1132:
    SAMSHR1132_25260
    MSSA476:
    SAS2582
    Mu3:
    SAHV_2682
    Mu50:
    SAV2698
    MW2:
    MW2617
    RF122:
    SAB2574
    ST398:
    SAPIG2744 (hoxN)
    T0131:
    SAT0131_02975
    TCH60:
    HMPREF0772_10489 (nixA)
    TW20:
    SATW20_28330
    USA300_TCH1516:
    USA300HOU_2699
    VC40:
    SAVC_12360

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIKYHVMKEGYILTVFKNERLSWLPYIAIVILLHVIGFSFLWIAGKDHHILFGMGILAYT
    N315            ------------MTVFKNERLSWLPYIAIVILLHVIGFSFLWIAGKDHHILFGMGILAYT
    NCTC8325        ------------MTVFKNERLSWLPYIAIVILLHVIGFSFLWIAGKDHHILFGMGILAYT
    Newman          MIKYHVMKEGYILTVFKNERLSWLPYIAIVILLHVIGFSFLWIAGKDHHILFGMGILAYT
    USA300_FPR3757  ------------MTVFKNERLSWLPYIAIVILLHVIGFSFLWIAGKDHHILFGMGILAYT
                                :***********************************************

    COL             LGLRHAFDADHIAAIDNTVRKLLQQRKDPSGVGFYFSIGHSSVVFLMAVFLGVSVKWAKD
    N315            LGLRHAFDADHIAAIDNTVRKLLQQRKDPSGVGFYFSIGHSSVVFLMAVFLGISVKWAKD
    NCTC8325        LGLRHAFDADHIAAIDNTVRKLLQQRKDPSGVGFYFSIGHSSVVFLMAVFLGVSVKWAKD
    Newman          LGLRHAFDADHIAAIDNTVRKLLQQRKDPSGVGFYFSIGHSSVVFLMAVFLGVSVKWAKD
    USA300_FPR3757  LGLRHAFDADHIAAIDNTVRKLLQQRKDPSGVGFYFSIGHSSVVFLMAVFLGVSVKWAKD
                    ****************************************************:*******

    COL             ELPHFQDIGGTIGTLVSGFFLVLIGVLNLIILISLINLFAKLRREHIEEAEVDALLESRG
    N315            ELPHFQDIGGTIGTLVSGFFLVLIGVLNLIILISLINLFAKLRREHIEEAEVDVLLESRG
    NCTC8325        ELPHFQDIGGTIGTLVSGFFLVLIGVLNLIILISLINLFAKLRREHIEEAEVDALLESRG
    Newman          ELPHFQDIGGTIGTLVSGFFLVLIGVLNLIILISLINLFAKLRREHIEEAEVDALLESRG
    USA300_FPR3757  ELPHFQDIGGTIGTLVSGFFLVLIGVLNLIILISLINLFAKLRREHIEEAEVDALLESRG
                    *****************************************************.******

    COL             LVSRFVGPYFKLITRSWHVLPLGFLFGLGFDTASEIALLALSSGASQQAISFIGILSLPI
    N315            FVSRFVGPYFKLITRSWHVLPLGFLFGLGFDTASEIALLALSSGASQQAISFIGILSLPI
    NCTC8325        LVSRFVGPYFKLITRSWHVLPLGFLFGLGFDTASEIALLALSSGASQQAISFIGILSLPI
    Newman          LVSRFVGPYFKLITRSWHVLPLGFLFGLGFDTASEIALLALSSGASQQAISFIGILSLPI
    USA300_FPR3757  LVSRFVGPYFKLITRSWHVLPLGFLFGLGFDTASEIALLALSSGASQQAISFIGILSLPI
                    :***********************************************************

    COL             LFASGMSLLDTLDGVVMKYAYNWAFFNPIRKIYYNITITAISVMAALVIGMIELLQILAD
    N315            LFASGMSLLDTLDGVVMKYAYNWAFFNPIRKIYYNITITAISVMAALVIGMIELLQILAD
    NCTC8325        LFASGMSLLDTLDGVVMKYAYNWAFFNPIRKIYYNITITAISVMAALVIGMIELLQILAD
    Newman          LFASGMSLLDTLDGVVMKYAYNWAFFNPIRKIYYNITITAISVMAALVIGMIELLQILAD
    USA300_FPR3757  LFASGMSLLDTLDGVVMKYAYNWAFFNPIRKIYYNITITAISVMAALVIGMIELLQILAD
                    ************************************************************

    COL             KLDLHGAFWAFIGSIEFDYLGYILVALFLITWLISSLIWKFGRIEHKWSR
    N315            KLDLHGAFWAFIGSIEFDYLGYILVALFLITWLISSLIWKFGRIEHKWSK
    NCTC8325        KLDLHGAFWAFIGSIEFDYLGYILVALFLITWLISSLIWKFGRIEHKWSR
    Newman          KLDLHGAFWAFIGSIEFDYLGYILVALFLITWLISSLIWKFGRIEHKWSR
    USA300_FPR3757  KLDLHGAFWAFIGSIEFDYLGYILVALFLITWLISSLIWKFGRIEHKWSR
                    *************************************************: